Nucleocapsid/NP Protein, HTNV (sf9, His)
Based on 1 publication(s) in Google Scholar
Nucleocapsid/NP belongs to the hantavirus nucleocapsid protein family. Nucleocapsid/NP Protein, HTNV (sf9, His) is the recombinant Virus-derived Nucleocapsid/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nucleocapsid/NP belongs to the hantavirus nucleocapsid protein family. Nucleocapsid/NP Protein, HTNV (sf9, His) is the recombinant Virus-derived Nucleocapsid/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Nucleocapsid (NP) is a member of the hantavirus nucleocapsid protein family.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q91LN7 (M1-L429)
-
Gene ID/
-
Molecular Construction
-
N-term
-
HTNV NP (M1-L429)
Accession # Q91LN7 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
Hantaan virus HTNV (strain 84FLi) Nucleocapsid / NP Protein (His)
-
AA Sequence
MATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDREGVAASIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSYGNVLDLNHLDIDEPTGQTADWLSIVIYLTSFVVPILLKALYMLTTRGRQTTKDNKGTRIRFKDDSSFEDVNGIRKPKHLYVSLPNAQSSMKAEEITPGRYRTAICGLYPAQIKARQMISPVMSVIGFLALAKDWSDRIEQWLSEPCKLLPDTAAVSLHGGPATNRDYLRQRQVALGNMETKESKAIRQHAESAGCSMIEDIESPSSIWVFAGAPNRCPPTCLFIAGIAELGAFFSILQDMRNTIMASKTVGTSEEKLRKKSSFYQSYLRRTQSMGIQLDQRIIVLFMVAWGKEAVDNFHLGDDMDPELRTLAQSLIDVKVKEISNQEPLKL
-
Predicted Molecular Mass
49.7 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 20 % glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
