OBP2B Protein, Human (HEK293, Fc)
The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, Fc) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, Fc) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-mFc labeled tag.
Background
The OBP2B protein is implicated in the probable binding and transportation of small hydrophobic volatile molecules. This suggests a role in molecular recognition and transport processes, particularly for small, lipophilic compounds. The specificity of OBP2B for such molecules implies its potential involvement in sensory or signaling pathways where the recognition and transport of volatile compounds are crucial. Further exploration of the ligands bound by OBP2B and the physiological contexts in which it operates will contribute to a more comprehensive understanding of its function in molecular transport and potential implications in cellular responses to environmental cues.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q9NPH6-1 (L16-H170)
-
Gene ID29989 [NCBI]
-
Molecular Construction
-
N-term
-
OBP2B (L16-H170)
Accession # Q9NPH6-1 -
mFc
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
OBP2B; Odorant-Binding Protein 2b; Odorant Binding Protein 2B; HOBPIIb; LCN14; OBPIIb; Odorant-Binding Protein IIb
-
AA Sequence
LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH
-
Predicted Molecular Mass
44.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
