OTUD2 Protein, Human
OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.
Background
OTUD2, a hydrolase with pivotal roles in cellular processes, is actively involved in endoplasmic reticulum-associated degradation (ERAD) by removing conjugated ubiquitin from misfolded lumenal proteins. It contributes to the ERAD mechanism by potentially trimming ubiquitin chains on associated substrates, facilitating their passage through the VCP/p97 pore. Specifically, OTUD2 exhibits deubiquitination activity towards 'Lys-27', 'Lys-29', and 'Lys-33'-linked polyubiquitin chains, as well as 'Lys-11'-linked ubiquitin chains. The ability to cleave both polyubiquitin and di-ubiquitin underscores its versatility. Beyond ERAD, OTUD2 may play a crucial role in macroautophagy, influencing the clearance of damaged lysosomes. Its involvement in autophagy includes recruiting PLAA, UBXN6, and VCP to damaged lysosome membranes adorned with K48-linked ubiquitin chains, facilitating their removal and promoting autophagosome formation. This multifaceted functionality highlights OTUD2's significance in cellular quality control mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q5VVQ6 (F2-V348)
-
Gene ID55432
-
Molecular Construction
-
N-term
-
OTUD2 (F2-V348)
Accession # Q5VVQ6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
YOD1; YOD1 Deubiquitinase; OTUD2; DUBA8; YOD1 OTU Deubiquinating Enzyme 1 Homolog (Yeast); OTU Domain-Containing Protein 2; Ubiquitin Thioesterase OTU1; HIV-1-Induced Protease 7; DKFZp451J1719; DUBA-8; HsHIN7; HIN-7; YOD1 OTU Deubiquinating Enzyme 1 Homolog (S. Cerev
-
AA Sequence
FGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
