OTUD2 Protein, Human

OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.

Background

OTUD2, a hydrolase with pivotal roles in cellular processes, is actively involved in endoplasmic reticulum-associated degradation (ERAD) by removing conjugated ubiquitin from misfolded lumenal proteins. It contributes to the ERAD mechanism by potentially trimming ubiquitin chains on associated substrates, facilitating their passage through the VCP/p97 pore. Specifically, OTUD2 exhibits deubiquitination activity towards 'Lys-27', 'Lys-29', and 'Lys-33'-linked polyubiquitin chains, as well as 'Lys-11'-linked ubiquitin chains. The ability to cleave both polyubiquitin and di-ubiquitin underscores its versatility. Beyond ERAD, OTUD2 may play a crucial role in macroautophagy, influencing the clearance of damaged lysosomes. Its involvement in autophagy includes recruiting PLAA, UBXN6, and VCP to damaged lysosome membranes adorned with K48-linked ubiquitin chains, facilitating their removal and promoting autophagosome formation. This multifaceted functionality highlights OTUD2's significance in cellular quality control mechanisms.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • OTUD2 (F2-V348)
      Accession # Q5VVQ6
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YOD1; YOD1 Deubiquitinase; OTUD2; DUBA8; YOD1 OTU Deubiquinating Enzyme 1 Homolog (Yeast); OTU Domain-Containing Protein 2; Ubiquitin Thioesterase OTU1; HIV-1-Induced Protease 7; DKFZp451J1719; DUBA-8; HsHIN7; HIN-7; YOD1 OTU Deubiquinating Enzyme 1 Homolog (S. Cerev

  • AA Sequence

    FGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00