1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. OTUD2 Protein, Human

OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OTUD2 is a key hydrolase in cellular processes that actively participates in endoplasmic reticulum-associated degradation (ERAD) by deubiquitinating misfolded luminal proteins. It trims ubiquitin chains from the substrate, helping them pass through the VCP/p97 pore. OTUD2 Protein, Human is the recombinant human-derived OTUD2 protein, expressed by E. coli , with tag free.

Background

OTUD2, a hydrolase with pivotal roles in cellular processes, is actively involved in endoplasmic reticulum-associated degradation (ERAD) by removing conjugated ubiquitin from misfolded lumenal proteins. It contributes to the ERAD mechanism by potentially trimming ubiquitin chains on associated substrates, facilitating their passage through the VCP/p97 pore. Specifically, OTUD2 exhibits deubiquitination activity towards 'Lys-27', 'Lys-29', and 'Lys-33'-linked polyubiquitin chains, as well as 'Lys-11'-linked ubiquitin chains. The ability to cleave both polyubiquitin and di-ubiquitin underscores its versatility. Beyond ERAD, OTUD2 may play a crucial role in macroautophagy, influencing the clearance of damaged lysosomes. Its involvement in autophagy includes recruiting PLAA, UBXN6, and VCP to damaged lysosome membranes adorned with K48-linked ubiquitin chains, facilitating their removal and promoting autophagosome formation. This multifaceted functionality highlights OTUD2's significance in cellular quality control mechanisms.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q5VVQ6 (F2-V348)

Gene ID

55432

Molecular Construction
N-term
OTUD2 (F2-V348)
Accession # Q5VVQ6
C-term
Protein Length

Partial

Synonyms
YOD1; Ubiquitin thioesterase OTU1; DUBA-8; HIV-1-induced protease 7; HIN-7; HsHIN7; OTU domain-containing protein 2
AA Sequence

FGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

OTUD2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OTUD2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OTUD2 Protein, Human
Cat. No.:
HY-P701482
Quantity:
MCE Japan Authorized Agent: