OTUD6A Protein, Human
The OTUD5 protein is a deubiquitinating enzyme with complex regulatory functions that acts as a negative regulator in the innate immune system. It exhibits peptidase activity against "Lys-48" and "Lys-63" linked polyubiquitin chains, and in vitro, it can cleave "Lys-11" linked ubiquitin chains. OTUD6A Protein, Human is the recombinant human-derived OTUD6A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The OTUD5 protein is a deubiquitinating enzyme with complex regulatory functions that acts as a negative regulator in the innate immune system. It exhibits peptidase activity against "Lys-48" and "Lys-63" linked polyubiquitin chains, and in vitro, it can cleave "Lys-11" linked ubiquitin chains. OTUD6A Protein, Human is the recombinant human-derived OTUD6A protein, expressed by E. coli , with tag free.
Background
OTUD6A is a deubiquitinating enzyme known for its ability to hydrolyze various types of polyubiquitin chains. Specifically, OTUD6A exhibits deubiquitinating activity towards 'Lys-27', 'Lys-29', 'Lys-33', and 'Lys-11'-linked polyubiquitin chains. This enzymatic function involves the cleavage of ubiquitin molecules from substrate proteins, contributing to the regulation of protein degradation and cellular signaling pathways. As a member of the ovarian tumor domain-containing family of deubiquitinases, OTUD6A plays a role in modulating ubiquitin-dependent processes, providing a fine-tuning mechanism for cellular protein homeostasis and signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q7L8S5 (M1-L288)
-
Gene ID139562
-
Molecular Construction
-
N-term
-
OTUD6A (M1-L288)
Accession # Q7L8S5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
OTUD6A; FLJ25831; OTU Deubiquitinase 6A; OTU Domain Containing 6A; DUBA2; HIN-6 Protease; HSHIN6; DUBA-2; OTU Domain-Containing Protein 6A
-
AA Sequence
MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQADSPTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)