1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. OTUD6A Protein, Human

The OTUD5 protein is a deubiquitinating enzyme with complex regulatory functions that acts as a negative regulator in the innate immune system. It exhibits peptidase activity against "Lys-48" and "Lys-63" linked polyubiquitin chains, and in vitro, it can cleave "Lys-11" linked ubiquitin chains. OTUD6A Protein, Human is the recombinant human-derived OTUD6A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The OTUD5 protein is a deubiquitinating enzyme with complex regulatory functions that acts as a negative regulator in the innate immune system. It exhibits peptidase activity against "Lys-48" and "Lys-63" linked polyubiquitin chains, and in vitro, it can cleave "Lys-11" linked ubiquitin chains. OTUD6A Protein, Human is the recombinant human-derived OTUD6A protein, expressed by E. coli , with tag free.

Background

OTUD6A is a deubiquitinating enzyme known for its ability to hydrolyze various types of polyubiquitin chains. Specifically, OTUD6A exhibits deubiquitinating activity towards 'Lys-27', 'Lys-29', 'Lys-33', and 'Lys-11'-linked polyubiquitin chains. This enzymatic function involves the cleavage of ubiquitin molecules from substrate proteins, contributing to the regulation of protein degradation and cellular signaling pathways. As a member of the ovarian tumor domain-containing family of deubiquitinases, OTUD6A plays a role in modulating ubiquitin-dependent processes, providing a fine-tuning mechanism for cellular protein homeostasis and signaling.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q7L8S5 (M1-L288)

Gene ID

139562

Molecular Construction
N-term
OTUD6A (M1-L288)
Accession # Q7L8S5
C-term
Protein Length

Full Length

Synonyms
OTUD6A; OTU domain-containing protein 6A; DUBA-2
AA Sequence

MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQADSPTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

OTUD6A Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OTUD6A Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OTUD6A Protein, Human
Cat. No.:
HY-P701484
Quantity:
MCE Japan Authorized Agent: