OX1R Protein, Human (HEK293, Flag)
OX1R, a moderately selective excitatory receptor, binds orexin-A and orexin-B neuropeptides. Upon orexin-A binding, OX1R activates cellular events, elevating cytoplasmic Ca(2+) levels. This interaction positions OX1R as a mediator in orexin neuropeptide signaling, influencing intracellular calcium dynamics in response to orexin-A. OX1R Protein, Human (HEK293, Flag) is the recombinant human-derived OX1R protein, expressed by HEK293 , with N-Flag labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OX1R, a moderately selective excitatory receptor, binds orexin-A and orexin-B neuropeptides. Upon orexin-A binding, OX1R activates cellular events, elevating cytoplasmic Ca(2+) levels. This interaction positions OX1R as a mediator in orexin neuropeptide signaling, influencing intracellular calcium dynamics in response to orexin-A. OX1R Protein, Human (HEK293, Flag) is the recombinant human-derived OX1R protein, expressed by HEK293 , with N-Flag labeled tag.
Background
OX1R, a moderately selective excitatory receptor, demonstrates an affinity for both orexin-A and orexin-B neuropeptides. Upon binding with orexin-A, OX1R initiates a cascade of cellular events, leading to an elevation in cytoplasmic Ca(2+) levels. This interaction highlights OX1R's role as a mediator in orexin neuropeptide signaling, contributing to the modulation of intracellular calcium dynamics in response to orexin-A binding.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Flag
-
Accession
O43613 (E28-A253, E286-L380, E46A, I85L, V95A, R162L, N194A, L198A, Y211A, L304V, C339A, C375W, C376W)
-
Gene ID3061
-
Protein Length
Partial
-
Synonyms
HCRTR1; Hypocretin Receptor Type 1; Hypocretin Receptor 1; Orexin Receptor Type 1; ORXR1; Orexin Receptor 1; OX1R; Ox-1-R; OXR1; Ox1-R; Orexin/Hypocretin Receptor Type 1; Ox1R; Hypocretin (Orexin) Receptor 1
-
AA Sequence
EVKQMRARRKTAKMLMVVVLVFALCYLPISVLNVLKRVFGMFRQASDREAVYAAFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSWWLPGL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
