1. Recombinant Proteins
  2. Receptor Proteins
  3. OX1R Protein, Human (HEK293, Flag)

OX1R, a moderately selective excitatory receptor, binds orexin-A and orexin-B neuropeptides. Upon orexin-A binding, OX1R activates cellular events, elevating cytoplasmic Ca(2+) levels. This interaction positions OX1R as a mediator in orexin neuropeptide signaling, influencing intracellular calcium dynamics in response to orexin-A. OX1R Protein, Human (HEK293, Flag) is the recombinant human-derived OX1R protein, expressed by HEK293 , with N-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OX1R, a moderately selective excitatory receptor, binds orexin-A and orexin-B neuropeptides. Upon orexin-A binding, OX1R activates cellular events, elevating cytoplasmic Ca(2+) levels. This interaction positions OX1R as a mediator in orexin neuropeptide signaling, influencing intracellular calcium dynamics in response to orexin-A. OX1R Protein, Human (HEK293, Flag) is the recombinant human-derived OX1R protein, expressed by HEK293 , with N-Flag labeled tag.

Background

OX1R, a moderately selective excitatory receptor, demonstrates an affinity for both orexin-A and orexin-B neuropeptides. Upon binding with orexin-A, OX1R initiates a cascade of cellular events, leading to an elevation in cytoplasmic Ca(2+) levels. This interaction highlights OX1R's role as a mediator in orexin neuropeptide signaling, contributing to the modulation of intracellular calcium dynamics in response to orexin-A binding.

Species

Human

Source

HEK293

Tag

N-Flag

Accession

O43613 (E28-A253, E286-L380, E46A, I85L, V95A, R162L, N194A, L198A, Y211A, L304V, C339A, C375W, C376W)

Gene ID

3061

Protein Length

Partial

Synonyms
HCRTR1; Orexin/Hypocretin receptor type 1; Hypocretin receptor type 1; Orexin receptor type 1; Ox-1-R; Ox1-R; Ox1R
AA Sequence

EVKQMRARRKTAKMLMVVVLVFALCYLPISVLNVLKRVFGMFRQASDREAVYAAFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSWWLPGL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

OX1R Protein, Human (HEK293, Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OX1R Protein, Human (HEK293, Flag)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OX1R Protein, Human (HEK293, Flag)
Cat. No.:
HY-P703944
Quantity:
MCE Japan Authorized Agent: