PADI2 Protein, Cynomolgus (sf9, His)
The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.
- Species: Cynomolgus
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.
Background
Peptidyl arginine deiminase 2 (PADI2) is an enzyme that catalyzes the deimination of arginine residues in proteins. This post-translational modification, also known as citrullination, involves the conversion of arginine to citrulline through the removal of an amino group. Citrullination plays a crucial role in various biological processes, including the regulation of gene expression, immune responses, and the formation of certain protein structures. PADI2-mediated deimination is implicated in the pathogenesis of autoimmune diseases such as rheumatoid arthritis, where citrullinated proteins are often targets of the immune system. It has to succinctly outline PADI2's catalytic function in introducing citrulline modifications to arginine residues, emphasizing its role in modulating protein structure and function.
Technical Parameters
-
Species Cynomolgus
-
Source sf9 insect cells
-
Tag N-His
-
Accession
A0A2K5TST4 (M1-P665)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
PADI2 (M1-P665)
Accession # A0A2K5TST4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PADI2; Protein-Arginine Deiminase Type-2; Peptidyl Arginine Deiminase 2; PAD-H19; PDI2; PAD2; KIAA0994; CDNA FLJ61278, Highly Similar To Protein-Arginine Deiminase Type-2; Peptidyl Arginine Deiminase, Type II; Peptidylarginine Deiminase II; Protein-Argini
-
AA Sequence
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP
-
Predicted Molecular Mass
77.6 kDa
-
Molecular Weight
Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
