1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. PAK2 Protein, Human (sf9, GST)

PAK2 Protein, Human (sf9, GST) is the recombinant human-derived PAK2, expressed by Sf9 insect cells , with GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAK2 Protein, Human (sf9, GST) is the recombinant human-derived PAK2, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

PAK2 is a serine/threonine protein kinase involved in diverse signaling pathways regulating cytoskeleton dynamics, cell motility, cell cycle progression, apoptosis, and proliferation. It acts as a downstream effector of CDC42/RAC1 GTPases, requiring binding to active CDC42/RAC1 for conformational change and autophosphorylation. Full-length PAK2 promotes cell survival/growth, phosphorylates MAPK4/MAPK6 to activate MAPKAPK5 (regulating F-actin polymerization and migration), and mediates EGF-induced proliferation via JUN phosphorylation. Other substrates include histone H4 (nucleosome assembly), BAD, S6 ribosomal protein, and MBP. PAK2 inhibits CASP7 activity through phosphorylation and performs kinase-independent roles (e.g., mitotic spindle orientation) with ARHGEF7/GIT1. Under apoptotic stimuli (e.g., DNA damage), caspase-cleaved PAK2 generates PAK-2p34, which translocates to the nucleus to drive apoptosis via JNK signaling; caspase-activated PAK2 also phosphorylates MKNK1 to suppress translation.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q13177 (M1-R524)

Gene ID

5062

Protein Length

Full Length

Synonyms
PAK2; p21 (RAC1) activated kinase 2; KNO2; PAK65; PAKgamma
AA Sequence

MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PAK2 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAK2 Protein, Human (sf9, GST)
Cat. No.:
HY-P702745
Quantity:
MCE Japan Authorized Agent: