PAK2 Protein, Human (sf9, GST)
PAK2 Protein, Human (sf9, GST) is the recombinant human-derived PAK2, expressed by Sf9 insect cells , with GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PAK2 Protein, Human (sf9, GST) is the recombinant human-derived PAK2, expressed by Sf9 insect cells , with GST labeled tag. ,
Background
PAK2 is a serine/threonine protein kinase involved in diverse signaling pathways regulating cytoskeleton dynamics, cell motility, cell cycle progression, apoptosis, and proliferation. It acts as a downstream effector of CDC42/RAC1 GTPases, requiring binding to active CDC42/RAC1 for conformational change and autophosphorylation. Full-length PAK2 promotes cell survival/growth, phosphorylates MAPK4/MAPK6 to activate MAPKAPK5 (regulating F-actin polymerization and migration), and mediates EGF-induced proliferation via JUN phosphorylation. Other substrates include histone H4 (nucleosome assembly), BAD, S6 ribosomal protein, and MBP. PAK2 inhibits CASP7 activity through phosphorylation and performs kinase-independent roles (e.g., mitotic spindle orientation) with ARHGEF7/GIT1. Under apoptotic stimuli (e.g., DNA damage), caspase-cleaved PAK2 generates PAK-2p34, which translocates to the nucleus to drive apoptosis via JNK signaling; caspase-activated PAK2 also phosphorylates MKNK1 to suppress translation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q13177 (M1-R524)
-
Gene ID5062
-
Protein Length
Full Length
-
Synonyms
PAK2; P21 (CDKN1A)-Activated Kinase 2; P21 (RAC1) Activated Kinase 2; P21-Activated Kinase 2; PAK65; Gamma-PAK; P21 Protein (Cdc42/Rac)-Activated Kinase 2; PAK-2; S6/H4 Kinase; P58; PAKgamma; Non-Specific Serine/Threonine Protein Kinase; Serine/Threonine-
-
AA Sequence
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
