PAK3 Protein, Human (sf9)

PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3 Protein, Human (sf9) is the recombinant human-derived PAK3, expressed by Sf9 insect cells, with tag-free.

PAK3, a serine/threonine protein kinase, assumes a pivotal role in diverse signaling pathways, influencing cytoskeleton dynamics, cell migration, and cell cycle regulation. Its involvement in dendritic spine morphogenesis, synapse formation, and plasticity underscores its significance in neuronal processes. As a downstream effector of small GTPases CDC42 and RAC1, PAK3 undergoes activation through their binding, triggering autophosphorylation on multiple serine and/or threonine residues. The kinase activity of PAK3 extends to phosphorylating MAPK4 and MAPK6, activating the downstream target MAPKAPK5, which modulates F-actin polymerization and cell migration. Furthermore, PAK3 phosphorylates TNNI3/troponin I, impacting calcium sensitivity and relaxation kinetics of thin myofilaments. Its indispensable role in early neuronal development is evident, particularly in hippocampal neurons, where it facilitates dendritic spine formation and excitatory synapse establishment, possibly by regulating actomyosin contractility through myosin II regulatory light chain phosphorylation. The multifaceted functions of PAK3 highlight its intricate contributions to cellular processes critical for neuronal structure and function.

Human

Sf9 insect cells

Tag Free

O75914-1 (M1-R559)

5063

Full Length of Isoform-1

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.