1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. p21-Activated Kinase 3
  5. PAK3 Protein, Human (sf9)

PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3 Protein, Human (sf9) is the recombinant human-derived PAK3, expressed by Sf9 insect cells, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3 Protein, Human (sf9) is the recombinant human-derived PAK3, expressed by Sf9 insect cells, with tag-free.

Background

PAK3, a serine/threonine protein kinase, assumes a pivotal role in diverse signaling pathways, influencing cytoskeleton dynamics, cell migration, and cell cycle regulation. Its involvement in dendritic spine morphogenesis, synapse formation, and plasticity underscores its significance in neuronal processes. As a downstream effector of small GTPases CDC42 and RAC1, PAK3 undergoes activation through their binding, triggering autophosphorylation on multiple serine and/or threonine residues. The kinase activity of PAK3 extends to phosphorylating MAPK4 and MAPK6, activating the downstream target MAPKAPK5, which modulates F-actin polymerization and cell migration. Furthermore, PAK3 phosphorylates TNNI3/troponin I, impacting calcium sensitivity and relaxation kinetics of thin myofilaments. Its indispensable role in early neuronal development is evident, particularly in hippocampal neurons, where it facilitates dendritic spine formation and excitatory synapse establishment, possibly by regulating actomyosin contractility through myosin II regulatory light chain phosphorylation. The multifaceted functions of PAK3 highlight its intricate contributions to cellular processes critical for neuronal structure and function.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

O75914-1 (M1-R559)

Gene ID

5063

Protein Length

Full Length of Isoform-1

Synonyms
PAK3; p21 protein (Cdc42/Rac)-activated kinase 3; bPAK; MRX30; MRX47; OPHN3; hPAK3; CDKN1A; PAK3beta; p21-activated kinase 3; beta-PAK; oligophrenin-3; OTTHUMP00000023856; p21 (CDKN1A)-activated kinase 3; serine/threonine-protein kinase PAK 3; EC 2.7.11.1
AA Sequence

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PAK3 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAK3 Protein, Human (sf9)
Cat. No.:
HY-P702746
Quantity:
MCE Japan Authorized Agent: