panD Protein, Corynebacterium jeikeium (FLAG, His)
The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium (FLAG, His) is the recombinant panD protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The panD protein plays a crucial role in cellular metabolism by catalyzing the pyruvyl-dependent decarboxylation of aspartate, thereby producing β-alanine. This enzyme activity represents a key step in the biosynthesis of pantothenic acid (vitamin B5), since beta-alanine is the precursor for the formation of this important cofactor. panD Protein, Corynebacterium jeikeium (FLAG, His) is the recombinant panD protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.
Background
The panD protein plays a crucial role in bacterial metabolism as it catalyzes the pyruvoyl-dependent decarboxylation of aspartate, resulting in the production of beta-alanine. This enzymatic activity is a key step in the biosynthesis of pantothenate, an essential precursor for coenzyme A (CoA) biosynthesis. CoA is involved in various fundamental cellular processes, serving as a cofactor for enzymes participating in fatty acid metabolism, the tricarboxylic acid (TCA) cycle, and other pathways. The pyruvoyl-dependent decarboxylation reaction catalyzed by panD represents a critical point in the regulation of pantothenate biosynthesis and, consequently, the cellular capacity for CoA production. Understanding the functions of panD provides insights into the intricate network of metabolic pathways in bacteria and highlights its potential as a target for antimicrobial interventions.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His;N-Flag
-
Accession
Q4JXL3 (M1-A138)
-
Gene ID3432856
-
Molecular Construction
-
N-term
-
Flag-6*His
-
panD (M1-A138)
Accession # Q4JXL3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
panD; Aspartate 1-decarboxylase; Aspartate alpha-decarboxylase; EC:4.1.1.11; jk0292
-
AA Sequence
MLRTMLKSKIHRATVTQADLHYVGSCTIDADLMEAADILEGEQIDIVDIDNGNRLTTYAITGDRGTGVIGINGAAARLISPGDLVIIIGYAQYSEEDLKNYASRVVFVDGNNKQVELGGDPAQVPDGSGLKNPRHPEA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
