PD-1 Protein, Mouse (Biotinylated, HEK293, His-Avi)
PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PD-1 protein, expressed by HEK293, with N-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PD-1 protein, expressed by HEK293, with N-6*His labeled tag.
Background
PD-1 (Programmed Cell Death 1) protein plays a crucial role in the negative regulation of the immune response, acting upstream of processes such as the negative regulation of apoptotic processes, negative regulation of tolerance induction, and positive regulation of apoptotic processes. This transmembrane protein is located on the external side of the plasma membrane and is expressed in the retina. PD-1 is associated with various diseases, including autoimmune diseases, hepatitis B and C, hepatocellular carcinoma, and lupus nephritis. The biased expression of PD-1 in adult thymus and ovary suggests its involvement in immune regulation within these tissues.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
NP_032824 (L25-Q167)
-
Gene ID18566
-
Molecular Construction
-
N-term
-
PD-1 (L25-Q167)
Accession # NP_032824 -
Avi-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
PDCD1; Systemic Lupus Erythematosus Susceptibility 2; Prev. SLEB2; HPD-1; PD1; Programmed Cell Death 1 Protein; Programmed Cell Death Protein 1; CD279 Antigen; CD279; ADMIO4; HSLE1; AIMTBS; PD-1; HPD-L; Programmed Cell Death 1; Protein PD-1
-
AA Sequence
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 37-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)