PDK1 Protein, Human (Inactive, sf9, His-GST)
PDK1 protein is a key kinase that controls glucose and fatty acid metabolism by phosphorylating pyruvate dehydrogenase subunits PDHA1 and PDHA2. This molecular switch inhibits pyruvate dehydrogenase, fine-tunes metabolite flux and downregulates aerobic respiration. PDK1, Human (Inactive, sf9, His-GST) is the recombinant human-derived PDK1 protein, expressed by Sf9 insect cells, with labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PDK1 protein is a key kinase that controls glucose and fatty acid metabolism by phosphorylating pyruvate dehydrogenase subunits PDHA1 and PDHA2. This molecular switch inhibits pyruvate dehydrogenase, fine-tunes metabolite flux and downregulates aerobic respiration. PDK1, Human (Inactive, sf9, His-GST) is the recombinant human-derived PDK1 protein, expressed by Sf9 insect cells, with labeled tag.
Background
PDK1, a pivotal kinase, exerts significant control over glucose and fatty acid metabolism by phosphorylating the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This phosphorylation event acts as a molecular switch, inhibiting pyruvate dehydrogenase activity and finely tuning metabolite flux through the tricarboxylic acid cycle. Consequently, PDK1 down-regulates aerobic respiration and impedes the conversion of pyruvate to acetyl-coenzyme A. Beyond its metabolic functions, PDK1 emerges as a critical player in cellular responses to hypoxia, where it plays a key role in promoting cell proliferation under oxygen-deprived conditions. Moreover, PDK1 serves a protective role by shielding cells against apoptosis triggered by hypoxia and oxidative stress, showcasing its multifaceted contributions to cellular homeostasis and stress response pathways.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q15118-1 (R2-A436)
-
Gene ID5163
-
Molecular Construction
-
N-term
-
His-GST
-
PDK1 (R2-A436)
Accession # Q15118-1 -
C-term
-
-
Protein Length
Full Length of Isoform 1
-
Synonyms
PDK1; Mitochondrial Pyruvate Dehydrogenase, Lipoamide, Kinase Isoenzyme 1; Pyruvate Dehydrogenase Kinase 1; Pyruvate Dehydrogenase Kinase, Isozyme 1; [Pyruvate Dehydrogenase (Acetyl-Transferring)] Kinase Isozyme 1, Mitochondrial; Pyruvate Dehydrogenase Ki
-
AA Sequence
RLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
