Peptide deformylase Protein, S. aureus (His, SUMO)

Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (His, SUMO) is the recombinant staphylococcus aureus-derived Peptide deformylase protein, expressed by E. coli, with SUMO and N-6*His labeled tag.

Peptide deformylase, a crucial enzyme in protein biosynthesis, plays a pivotal role in cellular processes by catalyzing the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. While it requires at least a dipeptide for optimal efficiency, the enzyme displays broad specificity at positions beyond the N-terminal L-methionine. This activity ensures the proper maturation and functionality of proteins, highlighting the essential contribution of peptide deformylase in the intricate process of protein synthesis and modification.

Staphylococcus aureus

E. coli

SUMO;N-6*His

P68826 (M1-V183)

/

Full Length

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.