Peptide deformylase Protein, S. aureus (His, SUMO)
Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (His, SUMO) is the recombinant staphylococcus aureus-derived Peptide deformylase protein, expressed by E. coli, with SUMO and N-6*His labeled tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (His, SUMO) is the recombinant staphylococcus aureus-derived Peptide deformylase protein, expressed by E. coli, with SUMO and N-6*His labeled tag.
Background
Peptide deformylase, a crucial enzyme in protein biosynthesis, plays a pivotal role in cellular processes by catalyzing the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. While it requires at least a dipeptide for optimal efficiency, the enzyme displays broad specificity at positions beyond the N-terminal L-methionine. This activity ensures the proper maturation and functionality of proteins, highlighting the essential contribution of peptide deformylase in the intricate process of protein synthesis and modification.
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag SUMO;N-6*His
-
Accession
P68826 (M1-V183)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
Peptide deformylase (M1-V183)
Accession # P68826 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UTP25; MGC29875; Prev. C1orf107; UTP25, Small Subunit Processor Component; Prev. DIEXF; Digestive-Organ Expansion Factor Homolog; UTP25 Small Subunit Processor Component; Digestive Organ Expansion Factor Homolog; DEF; Chromosome 1 Open Reading Frame 107;
-
AA Sequence
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
-
Predicted Molecular Mass
36.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
