PLAU/uPA Protein, Cynomolgus (HEK293, His)
PLAU, also known as uPA (urokinase plasminogen activator), exhibits defects in conserved residues critical for propagation feature annotation. This defect in the PLAU/uPA protein prevents the propagation of specific functional characteristics associated with this protein. PLAU/uPA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PLAU, also known as uPA (urokinase plasminogen activator), exhibits defects in conserved residues critical for propagation feature annotation. This defect in the PLAU/uPA protein prevents the propagation of specific functional characteristics associated with this protein. PLAU/uPA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.
Background
PLAU, also known as uPA (urokinase plasminogen activator), exhibits a deficiency in the conserved residue(s) crucial for propagating feature annotation. This deficiency in PLAU/uPA protein hampers the propagation of specific functional characteristics associated with this protein. PLAU/uPA is a serine protease that functions in the plasminogen activation system, playing a pivotal role in the regulation of fibrinolysis and extracellular matrix remodeling. It converts plasminogen into plasmin, a protease that degrades fibrin clots and various extracellular matrix components. PLAU/uPA is involved in processes such as tissue remodeling, cell migration, angiogenesis, and cellular invasion. The deficiency of the conserved residue(s) in PLAU/uPA protein may have significant implications for fibrinolysis regulation and extracellular matrix dynamics, warranting further investigation into the functional consequences of this deficiency on the protein's biological activities.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5WND1 (S21-L430)
-
Gene ID102135886
-
Molecular Construction
-
N-term
-
PLAU (S21-L430)
Accession # A0A2K5WND1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLAU; Plasminogen Activator, Urinary; Plasminogen Activator, Urokinase; PLAU Protein; UPA; BDPLT5; Urokinase-Type Plasminogen Activator; U-PA; URK; ATF; U-Plasminogen Activator; QPD
-
AA Sequence
SRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKQLVQECMVQNCADGKKPSSPPEELQFQCGQRTLRPRFKIVGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSTYNDPPFGTSCEITGFGKENSTDYLYPERLKMTVVKLVSHQKCQQPHYYGSEVTTKMLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIHSHTREENGLAL
-
Predicted Molecular Mass
47.2 kDa
-
Molecular Weight
Approximately 23-25 kDa & 35-40 kDa & 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)