PLAU/uPA Protein, Cynomolgus (HEK293, His)

PLAU, also known as uPA (urokinase plasminogen activator), exhibits defects in conserved residues critical for propagation feature annotation. This defect in the PLAU/uPA protein prevents the propagation of specific functional characteristics associated with this protein. PLAU/uPA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PLAU, also known as uPA (urokinase plasminogen activator), exhibits defects in conserved residues critical for propagation feature annotation. This defect in the PLAU/uPA protein prevents the propagation of specific functional characteristics associated with this protein. PLAU/uPA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PLAU/uPA protein, expressed by HEK293 , with C-His labeled tag.

Background

PLAU, also known as uPA (urokinase plasminogen activator), exhibits a deficiency in the conserved residue(s) crucial for propagating feature annotation. This deficiency in PLAU/uPA protein hampers the propagation of specific functional characteristics associated with this protein. PLAU/uPA is a serine protease that functions in the plasminogen activation system, playing a pivotal role in the regulation of fibrinolysis and extracellular matrix remodeling. It converts plasminogen into plasmin, a protease that degrades fibrin clots and various extracellular matrix components. PLAU/uPA is involved in processes such as tissue remodeling, cell migration, angiogenesis, and cellular invasion. The deficiency of the conserved residue(s) in PLAU/uPA protein may have significant implications for fibrinolysis regulation and extracellular matrix dynamics, warranting further investigation into the functional consequences of this deficiency on the protein's biological activities.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PLAU (S21-L430)
      Accession # A0A2K5WND1
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLAU; Plasminogen Activator, Urinary; Plasminogen Activator, Urokinase; PLAU Protein; UPA; BDPLT5; Urokinase-Type Plasminogen Activator; U-PA; URK; ATF; U-Plasminogen Activator; QPD

  • AA Sequence

    SRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKQLVQECMVQNCADGKKPSSPPEELQFQCGQRTLRPRFKIVGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSTYNDPPFGTSCEITGFGKENSTDYLYPERLKMTVVKLVSHQKCQQPHYYGSEVTTKMLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIHSHTREENGLAL

  • Predicted Molecular Mass

    47.2 kDa

  • Molecular Weight

    Approximately 23-25 kDa & 35-40 kDa & 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00