PMM2 Protein, Human (His)

The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.

The PMM2 Protein plays a vital role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, essential for numerous critical mannosyl transfer reactions. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, contributing to various cellular processes such as protein glycosylation. PMM2's involvement in these pathways underscores its significance in cellular homeostasis and the proper functioning of glycosylation processes essential for the synthesis of various glycoconjugates with crucial biological functions.

Human

E. coli

C-6*His

O15305-1 (M1-S246)

5373  [NCBI]

Full Length of Isoform-1

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Approximately 29 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 50 mM NaCl, 6% trehalose, 0.02% Tween 20, 2 mM EDTA, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.