PMM2 Protein, Human (His)
Based on 1 Customer Validation
The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.
Background
The PMM2 Protein plays a vital role in the synthesis of GDP-mannose and dolichol-phosphate-mannose, essential for numerous critical mannosyl transfer reactions. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, contributing to various cellular processes such as protein glycosylation. PMM2's involvement in these pathways underscores its significance in cellular homeostasis and the proper functioning of glycosylation processes essential for the synthesis of various glycoconjugates with crucial biological functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O15305-1 (M1-S246)
-
Molecular Construction
-
N-term
-
PMM2 (M1-S246)
Accession # O15305-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PMM2; PMI; Prev. CDG1; Phosphomannose Isomerase 1; CDG1a; PMM 2; PMI1; Congenital Disorder Of Glycosylation, Type Ia; CDGS; Phosphomannomutase; Phosphomannomutase 2; Mannose-6-Phosphate Isomerase
-
AA Sequence
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
-
Predicted Molecular Mass
29.1 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 50 mM NaCl, 6% trehalose, 0.02% Tween 20, 2 mM EDTA, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)