PRL8A4 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.
The PRL8A4 Protein is implicated in the regulation of placental basal zone cells. Its role within this context suggests a potential influence on processes integral to placental development and function. The specific functions and molecular mechanisms associated with PRL8A4 in placental basal zone cells remain an area of interest and warrant further exploration to unravel its contribution to the intricate processes occurring in this critical region of the placenta. Understanding the involvement of PRL8A4 Protein in placental basal zone cells may offer insights into the molecular underpinnings of placental physiology and its implications for overall reproductive health.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
P33580 (I32-C239)
-
Gene ID59088 [NCBI]
-
Molecular Construction
-
N-term
-
PRL8A4 (I32-C239)
Accession # P33580 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Prolactin-8A4; Growth hormone-related placental protein 3; Placental prolactin-like protein H; PLP-H; PRL-like protein H; Prl8a4; Prlph
-
AA Sequence
IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC
-
Molecular Weight
Approximately 24 kDa.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
