PRNP/CD230 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The PRNP/CD230 protein is involved in multiple cellular processes and may affect neuronal development, synaptic plasticity, and myelin maintenance.It promotes myelin homeostasis, induces apoptosis, and interacts with other proteins.PRNP/CD230 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PRNP/CD230 protein is involved in multiple cellular processes and may affect neuronal development, synaptic plasticity, and myelin maintenance.It promotes myelin homeostasis, induces apoptosis, and interacts with other proteins.PRNP/CD230 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
PRNP/CD230 protein, while its primary physiological function remains unclear, is implicated in various cellular processes, suggesting potential roles in neuronal development, synaptic plasticity, and neuronal myelin sheath maintenance. It may contribute to myelin homeostasis by acting as an agonist for the ADGRG6 receptor and participating in iron uptake and homeostasis. Soluble oligomers of PRNP are demonstrated to be toxic to cultured neuroblastoma cells, inducing apoptosis in vitro. Association with GPC1, mediated by its heparan sulfate chains, directs PRNP to lipid rafts and provides Cu(2+) or Zn(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. The protein exhibits a monomeric state and can form homodimers, displaying a propensity to aggregate into amyloid fibrils characterized by a cross-beta spine. Copper binding may promote the oligomerization of PRNP. Interactions with GRB2, APP, ERI3/PRNPIP, SYN1, and ADGRG6 highlight its involvement in diverse cellular processes, while mislocalized cytosolically exposed PrP engages with MGRN1, altering MGRN1 subcellular location and causing lysosomal enlargement. Additional interactions with KIAA1191 and APP further emphasize the versatility of PRNP in cellular functions.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P04925 (K23-S230)
-
Molecular Construction
-
N-term
-
PRNP (K23-S230)
Accession # P04925 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRNP; PrP27-30; Prev. PRIP; ASCR; Prev. CJD; Gerstmann-Strausler-Scheinker Syndrome; Prev. GSS; Creutzfeldt-Jakob Disease; AltPrP; Fatal Familial Insomnia; PRP; Prion Protein (P27-30); Alternative Prion Protein; Prion-Related Protein; Major Prion Protein;
-
AA Sequence
KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRS
-
Predicted Molecular Mass
49.6 kDa
-
Molecular Weight
Approximately 60-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)