1. Recombinant Proteins
  2. CD Antigens
  3. Epithelial cell CD Proteins
  4. PRNP/CD230
  5. PRNP/CD230 Protein, Mouse (HEK293, Fc)

The PRNP/CD230 protein is involved in multiple cellular processes and may affect neuronal development, synaptic plasticity, and myelin maintenance.It promotes myelin homeostasis, induces apoptosis, and interacts with other proteins.PRNP/CD230 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PRNP/CD230 protein is involved in multiple cellular processes and may affect neuronal development, synaptic plasticity, and myelin maintenance.It promotes myelin homeostasis, induces apoptosis, and interacts with other proteins.PRNP/CD230 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PRNP/CD230 protein, while its primary physiological function remains unclear, is implicated in various cellular processes, suggesting potential roles in neuronal development, synaptic plasticity, and neuronal myelin sheath maintenance. It may contribute to myelin homeostasis by acting as an agonist for the ADGRG6 receptor and participating in iron uptake and homeostasis. Soluble oligomers of PRNP are demonstrated to be toxic to cultured neuroblastoma cells, inducing apoptosis in vitro. Association with GPC1, mediated by its heparan sulfate chains, directs PRNP to lipid rafts and provides Cu(2+) or Zn(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. The protein exhibits a monomeric state and can form homodimers, displaying a propensity to aggregate into amyloid fibrils characterized by a cross-beta spine. Copper binding may promote the oligomerization of PRNP. Interactions with GRB2, APP, ERI3/PRNPIP, SYN1, and ADGRG6 highlight its involvement in diverse cellular processes, while mislocalized cytosolically exposed PrP engages with MGRN1, altering MGRN1 subcellular location and causing lysosomal enlargement. Additional interactions with KIAA1191 and APP further emphasize the versatility of PRNP in cellular functions.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P04925 (K23-S230)

Gene ID
Molecular Construction
N-term
PRNP (K23-S230)
Accession # P04925
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Major prion protein; PrP; ALTPRP; PRIP; PRP; PRNP
AA Sequence

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRS

Molecular Weight

60-68 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRNP/CD230 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRNP/CD230 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRNP/CD230 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78023
Quantity:
MCE Japan Authorized Agent: