Betacellulin/BTC Protein, Mouse (N-His)
Based on 1 Customer Validation
Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.
Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes. BTC stimulates DNA synthesis in fibroblasts and vascular smooth muscle cells. BTC plays a role in regulating growth and/or differentiation of endocrine precursor cells of the fetal pancreas. BTC is found to convert amylase-secreting pancreatic AR42J cells into insulin-producing cells and to have a mitogenic effect in human undifferentiated pancreatic epithelial cells[1].
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is ≤0.9548 ng/mL, corresponding to a specific activity is ≥1.047×106 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q05928 (D32-Y111)
-
Gene ID12223 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
BTC (D32-Y111)
Accession # Q05928 -
C-term
-
-
Protein Length
Full Length of Betacellulin
-
Synonyms
BTC; Probetacellulin; Betacellulin; Betacellulin Isoform 2
-
AA Sequence
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0 or PBS, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
