Proinsulin Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag.

Background

Proinsulin Protein, encoded by this gene, is the precursor of insulin, a crucial peptide hormone that plays a pivotal role in regulating carbohydrate and lipid metabolism. Following the removal of the precursor signal peptide, proinsulin undergoes post-translational cleavage, generating three peptides: the B chain and A chain peptides, which covalently link to form insulin, and C-peptide. The binding of insulin to the insulin receptor (INSR) stimulates glucose uptake, a process integral to metabolic homeostasis. Various mutant alleles with diverse phenotypic effects, such as insulin-dependent diabetes mellitus, permanent neonatal diabetes mellitus, maturity-onset diabetes of the young type 10, and hyperproinsulinemia, have been identified. Notably, expression of this gene is predominantly restricted to the pancreas, emphasizing its central role in glucose regulation and metabolism within pancreatic tissues. Additionally, a read-through gene, INS-IGF2, overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region, further contributing to the complexity of regulatory mechanisms in this genomic locus.

Verified Bioactivity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 0.5182μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 0.5182 μg/mL. corresponding to a specific activity is 1929.7 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Proinsulin (F25-N110)
      Accession # NP_000198
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    INS; Proinsulin; Prev. IDDM1; PNDM4; Prev. IDDM2; IDDM; Insulin-Dependent Diabetes Mellitus 2; ILPR; Preproinsulin; IRDN; Insulin; MODY10

  • AA Sequence

    FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

  • Molecular Weight

    Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00