Proinsulin Protein, Human (His)

Proinsulin is the precursor of insulin, a key hormone that regulates carbohydrate and lipid metabolism. Post-translational cleavage produces insulin, which consists of B and A chain peptides and a C peptide linked by disulfide bonds. Proinsulin Protein, Human (His) is the recombinant human-derived Proinsulin protein, expressed by E. coli , with N-6*His labeled tag.

Proinsulin Protein, encoded by this gene, is the precursor of insulin, a crucial peptide hormone that plays a pivotal role in regulating carbohydrate and lipid metabolism. Following the removal of the precursor signal peptide, proinsulin undergoes post-translational cleavage, generating three peptides: the B chain and A chain peptides, which covalently link to form insulin, and C-peptide. The binding of insulin to the insulin receptor (INSR) stimulates glucose uptake, a process integral to metabolic homeostasis. Various mutant alleles with diverse phenotypic effects, such as insulin-dependent diabetes mellitus, permanent neonatal diabetes mellitus, maturity-onset diabetes of the young type 10, and hyperproinsulinemia, have been identified. Notably, expression of this gene is predominantly restricted to the pancreas, emphasizing its central role in glucose regulation and metabolism within pancreatic tissues. Additionally, a read-through gene, INS-IGF2, overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region, further contributing to the complexity of regulatory mechanisms in this genomic locus.

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 0.5182μg/mL.

• 
  Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 0.5182 μg/mL. corresponding to a specific activity is 1929.7 units/mg.

Human

E. coli

N-6*His

NP_000198.1 (F25-N110)

3630

Full Length of Mature Protein

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.