Copy Link Print Information

Prolactin R Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

The prolactin R protein is a receptor for prolactin that promotes multiple molecular interactions, such as association with SMARCA1, suggesting a possible involvement in chromatin remodeling. Its prolactin-dependent interaction with NEK3 and VAV2 suggests interactions that regulate responses to stimuli. Prolactin R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Prolactin R Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The prolactin R protein is a receptor for prolactin that promotes multiple molecular interactions, such as association with SMARCA1, suggesting a possible involvement in chromatin remodeling. Its prolactin-dependent interaction with NEK3 and VAV2 suggests interactions that regulate responses to stimuli. Prolactin R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Background

Prolactin R Protein functions as a receptor specifically designed for the anterior pituitary hormone prolactin. Facilitating cellular responses to prolactin, this receptor engages in diverse molecular interactions, including its association with SMARCA1, suggesting potential involvement in chromatin remodeling processes. Additionally, Prolactin R Protein interacts with NEK3 and VAV2 in a prolactin-dependent manner, indicating a regulated interplay in response to prolactin stimulation. These interactions underscore the receptor's pivotal role in transducing prolactin-mediated signals, influencing cellular processes, and contributing to the regulation of diverse physiological functions.

Verified Bioactivity

Immobilized Cynomolgus PRLR, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-PRLR Antibody, hFc Tag with the EC50 of ≤35 ng/mL determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession

    A0A2K5WXK1 (Q25-T236)

  • Gene ID
    102139140
  • Molecular Construction
    • N-term
    • Prolactin R (Q25-T236)
      Accession # A0A2K5WXK1
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PRLR; HPRLrI; Prolactin Receptor; PRL-R; Secreted Prolactin Binding Protein; MFAB; HPRL Receptor; HPRL; RI-PRLR

  • AA Sequence

    QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYVMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELTVEVKQPEDRKPYLWMKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFIMNDTT

  • Predicted Molecular Mass

    25.8 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Prolactin R Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Prolactin R Protein, Cynomolgus (HEK293, His) Product Image