1. Recombinant Proteins
  2. Receptor Proteins
  3. Prolactin R Protein, Cynomolgus (HEK293, His)

The prolactin R protein is a receptor for prolactin that promotes multiple molecular interactions, such as association with SMARCA1, suggesting a possible involvement in chromatin remodeling. Its prolactin-dependent interaction with NEK3 and VAV2 suggests interactions that regulate responses to stimuli. Prolactin R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The prolactin R protein is a receptor for prolactin that promotes multiple molecular interactions, such as association with SMARCA1, suggesting a possible involvement in chromatin remodeling. Its prolactin-dependent interaction with NEK3 and VAV2 suggests interactions that regulate responses to stimuli. Prolactin R Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Background

Prolactin R Protein functions as a receptor specifically designed for the anterior pituitary hormone prolactin. Facilitating cellular responses to prolactin, this receptor engages in diverse molecular interactions, including its association with SMARCA1, suggesting potential involvement in chromatin remodeling processes. Additionally, Prolactin R Protein interacts with NEK3 and VAV2 in a prolactin-dependent manner, indicating a regulated interplay in response to prolactin stimulation. These interactions underscore the receptor's pivotal role in transducing prolactin-mediated signals, influencing cellular processes, and contributing to the regulation of diverse physiological functions.

Biological Activity

Immobilized Cynomolgus PRLR, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-PRLR Antibody, hFc Tag with the EC50 of ≤35 ng/mL determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5WXK1 (Q25-T236)

Gene ID

102139140

Molecular Construction
N-term
Prolactin R (Q25-T236)
Accession # A0A2K5WXK1
8*His
C-term
Protein Length

Partial

Synonyms
PRL-R; HPRL; MFAB; Prolactin R
AA Sequence

QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYVMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELTVEVKQPEDRKPYLWMKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFIMNDTT

Molecular Weight

35-50 kDa, due to glycosylation

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin R Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Prolactin R Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin R Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700814
Quantity:
MCE Japan Authorized Agent: