PSCA Protein, Human (HEK293, His)

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, His) is the recombinant human-derived PSCA protein, expressed by HEK293, with C-His labeled tag.

The PSCA protein appears to play a role in the regulation of cell proliferation, exhibiting cell-proliferation inhibition activity in vitro. Additionally, PSCA may serve as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, particularly in vitro where it inhibits nicotine-induced signaling, potentially implicating alpha-3:beta-2- or alpha-7-containing nAChRs. This dual functionality suggests PSCA's involvement in cellular processes related to proliferation control and the modulation of nicotinic acetylcholine receptor activity, underscoring its potential significance in cellular physiology and signaling pathways.

Human

HEK293

C-His

O43653 (L12-S86)

8000

Partial

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Approximately 17-25 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hela-cell.html  [Content Brief]