PSCA Protein, Human (HEK293, His)

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, His) is the recombinant human-derived PSCA protein, expressed by HEK293, with C-His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Human
  • Source: HEK293
  • Speicherung:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biologische Aktivität

Beschreibung

PSCA protein plays a role in the regulation of cell proliferation and has shown an inhibitory effect on cell proliferation in vitro. In addition, PSCA may act as a modulator of nicotinic acetylcholine receptor (nAChR) activity, specifically inhibiting nicotine-induced signaling in vitro, possibly affecting α-3:β-2 or α-7-containing nAChRs. PSCA Protein, Human (HEK293, His) is the recombinant human-derived PSCA protein, expressed by HEK293, with C-His labeled tag.

Background

The PSCA protein appears to play a role in the regulation of cell proliferation, exhibiting cell-proliferation inhibition activity in vitro. Additionally, PSCA may serve as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, particularly in vitro where it inhibits nicotine-induced signaling, potentially implicating alpha-3:beta-2- or alpha-7-containing nAChRs. This dual functionality suggests PSCA's involvement in cellular processes related to proliferation control and the modulation of nicotinic acetylcholine receptor activity, underscoring its potential significance in cellular physiology and signaling pathways.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PSCA (L12-S86)
      Accession # O43653
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PSCA; LncPSCA; Prostate Stem Cell Antigen; PRO232

  • AA Sequence

    LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

  • Predicted Molecular Mass

    10.4 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Reinheit

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung) Konzentration (Stammlösung)
×
Volumen (Stammlösung) Volumen (Stammlösung)
=
Konzentration (Ziellösung) Konzentration (Ziellösung)
×
Volumen (Ziellösung) Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00