PSCA Protein, Mouse (HEK293, Fc)

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PSCA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The PSCA protein emerges as a versatile regulator, potentially involved in the modulation of cell proliferation and acting as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro experiments demonstrate its ability to inhibit nicotine-induced signaling, suggesting a potential interaction with alpha-3:beta-2- or alpha-7-containing nAChRs. The dual functionality of PSCA, influencing both cell proliferation and nicotinic acetylcholine receptor activity, underscores its significance in cellular processes and signaling pathways, hinting at its potential role in the intricate balance of cellular homeostasis.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • PSCA Protein (L21-N95)
      Accession # P57096
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PSCA; LncPSCA; Prostate Stem Cell Antigen; PRO232

  • AA Sequence

    LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

  • Predicted Molecular Mass

    34.5 kDa

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00