PSMD14 Protein, Mouse (His)

PSMD14 Protein, Mouse (His) is the recombinant mouse-derived PSMD14, expressed by E. coli , with C-6*His labeled tag. ,

PSMD14 is a component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in maintaining protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and eliminating proteins no longer needed. Thus, the proteasome participates in various cellular processes, including cell cycle progression, apoptosis, and DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. It contributes to the response to double-strand breaks (DSBs) by regulating non-homologous end joining (NHEJ) through cleavage of 'Lys-63'-linked polyubiquitin, promoting JMJD2A/KDM4A retention on chromatin and restricting TP53BP1 accumulation. Additionally, it facilitates homologous recombination repair by promoting RAD51 loading.

Mouse

E. coli

C-6*His

O35593 (M1-N166)

59029

Partial

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINAN

18.68 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.