PSMD14 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
PSMD14 Protein, Mouse (His) is the recombinant mouse-derived PSMD14, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PSMD14 Protein, Mouse (His) is the recombinant mouse-derived PSMD14, expressed by E. coli , with C-6*His labeled tag. ,
PSMD14 is a component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in maintaining protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and eliminating proteins no longer needed. Thus, the proteasome participates in various cellular processes, including cell cycle progression, apoptosis, and DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. It contributes to the response to double-strand breaks (DSBs) by regulating non-homologous end joining (NHEJ) through cleavage of 'Lys-63'-linked polyubiquitin, promoting JMJD2A/KDM4A retention on chromatin and restricting TP53BP1 accumulation. Additionally, it facilitates homologous recombination repair by promoting RAD51 loading.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
PSMD14 Stabilizes SLC7A11 to Ameliorate Glucocorticoid-Induced Osteoporosis by Suppressing Osteocyte Ferroptosis. [Abstract]2025 Aug;12(31):e14902. PMID: 40444470
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
O35593 (M1-N166)
-
Gene ID59029
-
Molecular Construction
-
N-term
-
O35593 PSMD14 (M1-N166)
Accession # -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PSMD14; 26S Proteasome Regulatory Subunit RPN11; Proteasome 26S Subunit, Non-ATPase 14; Ubiquitin C-Terminal Hydrolase PSMD14; POH1; Testis Tissue Sperm-Binding Protein Li 69n; 26S Proteasome Non-ATPase Regulatory Subunit 14; 26S Proteasome Regulatory Sub
-
AA Sequence
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINAN
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
