PTP4A2 Protein, Human (His)
Based on 1 Customer Validation
The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag.
PTP4A2 protein, a potent protein tyrosine phosphatase, plays a pivotal role in stimulating the progression from G1 into S phase during mitosis, contributing to cell cycle regulation. Intriguingly, PTP4A2 emerges as a promoter of tumorigenesis, showcasing its involvement in pathological processes associated with cancer development. Additionally, PTP4A2 exhibits inhibitory effects on geranylgeranyl transferase type II activity by disrupting the association between RABGGTA and RABGGTB, indicating its regulatory influence on intracellular signaling pathways. The multifaceted functions of PTP4A2 underscore its significance in cellular processes related to both cell cycle dynamics and the intricate mechanisms underlying tumor progression.
Measured by its ability to cleave a substrate, p-Nitrophenyl phosphate (pNPP). which can be measured by absorbance at 410 nm. The specific activity is 158.928 pmol/min/µg, as measured under the described conditions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q12974 (M1-Q167)
-
Molecular Construction
-
N-term
-
PTP4A2 (M1-Q167)
Accession # Q12974 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PTP4A2; Protein Tyrosine Phosphatase Type IVA, Member 2; Prev. PTP4A; Phosphatase Of Regenerating Liver 2; PTPCAAX2; PTP(CAAXII); HU-PP-1; Protein Tyrosine Phosphatase IVA2; PRL-2; Protein Tyrosine Phosphatase IVA; OV-1; Protein-Tyrosine Phosphatase 4a2;
-
AA Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
