PTPRG Protein, Human (His)
PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human (His) is the recombinant human-derived PTPRG protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human (His) is the recombinant human-derived PTPRG protein, expressed by E. coli , with N-6*His labeled tag.
Background
PTPRG protein, also known as protein tyrosine phosphatase receptor type G, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. This enzymatic activity allows PTPRG to regulate various cellular processes, including cell signaling, growth, differentiation, and adhesion. Through its tyrosine phosphatase activity, PTPRG serves as a crucial modulator of intracellular signaling pathways, interacting with and dephosphorylating specific tyrosine residues on target proteins to influence their function. Further research is needed to fully understand the physiological and pathological roles of PTPRG and its potential as a therapeutic target in various diseases characterized by dysregulated protein tyrosine phosphorylation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P23470 (P820-N1130)
-
Gene ID5793
-
Molecular Construction
-
N-term
-
6*His
-
PTPRG (P820-N1130)
Accession # P23470 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PTPRG; Receptor Tyrosine Phosphatase Gamma; Prev. PTPG; Alternative Protein PTPRG; RPTPG; PTPRG Protein; Receptor-Type Tyrosine-Protein Phosphatase Gamma; H_RG317H01.1; Protein Tyrosine Phosphatase Gamma; R-PTP-GAMMA; Protein Tyrosine Phosphatase, Recepto
-
AA Sequence
PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
