1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules
  4. PVRIG
  5. PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi)

PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P700818
Handling Instructions Technical Support

PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

Poliovirus receptor related immunoglobulin domain containing (PVRIG), a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. In humans, PVRIG is expressed on T cells (predominantly CD8+ T cells) and natural killer (NK) cells, but not on B cells, monocytes or neutrophils. PVRIG binds to a single ligand, poliovirus receptor-related 2 (PVRL2), and exerts an inhibitory effect on cytotoxic lymphocyte activity, likely via an ITIM-like motif in its intracellular domain. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG deficiency or PVRIG blockade can reduce the tumor size and prolong the survival of tumor-bearing mice through inhibiting NK cell and CD8+ T cell exhaustion. PVRIG blockade enhances natural killer cell killing of PVRL2hiPVRlo acute myeloid leukemia cells[1][2][3].

Species

Mouse

Source

HEK293

Tag

C-Avi;C-hFc

Accession

A0A1B0GS01 (S35-D165)

Gene ID

102640920

Molecular Construction
N-term
PVRIG (S35-D165)
Accession # A0A1B0GS01
hFc-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
C7orf15; CD112R; MGC104322; MGC138297; MGC2463; PVRIG; ALS2CR18; ALS2CR9; LPD; PREL-2; PREL2; RalGDS/AF-6; RMO1
AA Sequence

SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAVLHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVTFPHGSRVACRDLHRSDPGLSAPTPALNLQAD

Predicted Molecular Mass
42.7 kDa
분자량

Approximately 55-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P700818
수량:
MCE Japan Authorized Agent: