PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi)
PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (Biotinylated, HEK293, Fc-Avi) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
Poliovirus receptor related immunoglobulin domain containing (PVRIG), a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. In humans, PVRIG is expressed on T cells (predominantly CD8+ T cells) and natural killer (NK) cells, but not on B cells, monocytes or neutrophils. PVRIG binds to a single ligand, poliovirus receptor-related 2 (PVRL2), and exerts an inhibitory effect on cytotoxic lymphocyte activity, likely via an ITIM-like motif in its intracellular domain. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG deficiency or PVRIG blockade can reduce the tumor size and prolong the survival of tumor-bearing mice through inhibiting NK cell and CD8+ T cell exhaustion. PVRIG blockade enhances natural killer cell killing of PVRL2hiPVRlo acute myeloid leukemia cells[1][2][3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
A0A1B0GS01 (S35-D165)
-
Gene ID102640920
-
Molecular Construction
-
N-term
-
PVRIG (S35-D165)
Accession # A0A1B0GS01 -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
PVRIG; Poliovirus Receptor-Related Immunoglobulin Domain-Containing Protein; PVR Related Immunoglobulin Domain Containing; Poliovirus Receptor Related Immunoglobulin Domain Containing; C7orf15; Transmembrane Protein PVRIG; CD112R; Nectin-2 Receptor; CD112
-
AA Sequence
SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAVLHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVTFPHGSRVACRDLHRSDPGLSAPTPALNLQAD
-
Predicted Molecular Mass
42.7 kDa
-
Molecular Weight
Approximately 53-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Li J, et al. PVRIG is a novel natural killer cell immune checkpoint receptor in acute myeloid leukemia. Haematologica. 2021 Dec 1;106(12):3115-3124. [Content Brief]
[2]. Whelan S, et al. PVRIG and PVRL2 Are Induced in Cancer and Inhibit CD8+ T-cell Function. Cancer Immunol Res. 2019 Feb;7(2):257-268. [Content Brief]
[3]. Li Y, et al. Blockade of checkpoint receptor PVRIG unleashes anti-tumor immunity of NK cells in murine and human solid tumors. J Hematol Oncol. 2021 Jun 26;14(1):100. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
