Copy Link Print Information

RBP3 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

RBP3 Protein, or interphotoreceptor retinoid-binding protein (IRBP), crucially facilitates the transport of retinoids between retinol isomerase and visual pigments in the retina. Its role is essential for maintaining the visual pathway's integrity, ensuring proper synthesis and regeneration of visual pigments crucial for vision. RBP3 Protein, Human (His) is the recombinant human-derived RBP3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • RBP3 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RBP3 Protein, or interphotoreceptor retinoid-binding protein (IRBP), crucially facilitates the transport of retinoids between retinol isomerase and visual pigments in the retina. Its role is essential for maintaining the visual pathway's integrity, ensuring proper synthesis and regeneration of visual pigments crucial for vision. RBP3 Protein, Human (His) is the recombinant human-derived RBP3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

RBP3, known as interphotoreceptor retinoid-binding protein (IRBP), plays a crucial role in the visual system by facilitating the transport of 11-cis and all-trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments within the photoreceptor cells of the retina. Its role in shuttling retinoids is essential for maintaining the integrity and function of the visual pathway, ensuring the proper synthesis and regeneration of visual pigments crucial for vision.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P10745 (T321-L630)

  • Gene ID
    5949  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • RBP3 (T321-L630)
      Accession # P10745
    • C-term
  • Protein Length

    Partial

  • Synonyms

    RBP3; Retinol-Binding Protein 3; Retinol Binding Protein 3; Retinol-Binding Protein 3, Interstitial; IRBP; Retinol Binding Protein 3, Interstitial; Interphotoreceptor Retinoid-Binding Protein; Interstitial Retinol-Binding Protein 3; D10S64; Interstitial R

  • AA Sequence

    TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL

  • Predicted Molecular Mass

    35.2 kDa

  • Molecular Weight

    Approximately 38 kDa & 75-80 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RBP3 Protein, Human (His) Product Image
    1/16
  • RBP3 Protein, Human (His) Product Image