RBP5 Protein, Human
RBP5 actively transports retinol intracellularly. RBP5 Protein, Human is the recombinant human-derived RBP5 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
RBP5 actively transports retinol intracellularly. RBP5 Protein, Human is the recombinant human-derived RBP5 protein, expressed by E. coli , with tag free.
Background
RBP5 is actively involved in the intracellular transport of retinol.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P82980 (M1-R135)
-
Molecular Construction
-
N-term
-
RBP5 (M1-R135)
Accession # P82980 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RBP5; Retinol-Binding Protein 5; Retinol Binding Protein 5; HRBPiso; CRBP-III; Putative Cellular Retinol-Binding Protein CRBP III; CRBPIII; Retinol-Binding Protein 5, Cellular; CRBP3; Retinol Binding Protein 5, Cellular; Cellular Retinol-Binding Protein I
-
AA Sequence
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)