REG1A Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

Background

REG1A protein appears to function as an inhibitor of spontaneous calcium carbonate precipitation.

Verified Bioactivity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.023 μg/mL, corresponding to a specific activity is 977.517 units/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term

    • Accession # G8F4F8
    • His REG1A (Q23-N166)
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    REG1A; Regenerating Protein I Alpha; Prev. REG; Lithostathine-1-Alpha; PSPS1; REG-1-Alpha; PSPS; ICRF; PSP; Regenerating Islet-Derived 1 Alpha (Pancreatic Stone Protein, Pancreatic Thread Protein); PTP; Pancreatic Stone Protein, Secretory; Pancreatic Thre

  • AA Sequence

    QEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLVSYKSWDIGAPNSVNPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN

  • Molecular Weight

    Approximately 19 kDa & 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00