1. Recombinant Proteins
  2. Others
  3. REG1A Protein, Cynomolgus (HEK293, His)

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

Background

REG1A protein appears to function as an inhibitor of spontaneous calcium carbonate precipitation.

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.023 μg/mL, corresponding to a specific activity is 977.517 units/mg.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

G8F4F8 (Q23-N166)

Gene ID

/

Molecular Construction
N-term

Accession # G8F4F8
His REG1A (Q23-N166)
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lithostathine-1-alpha; ICRF; PSPS; PSPS1; REG
AA Sequence

QEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLVSYKSWDIGAPNSVNPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN

Molecular Weight

Approximately 17&20 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

REG1A Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

REG1A Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG1A Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77473
Quantity:
MCE Japan Authorized Agent: