REG1A Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.
Background
REG1A protein appears to function as an inhibitor of spontaneous calcium carbonate precipitation.
Verified Bioactivity
Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.023 μg/mL, corresponding to a specific activity is 977.517 units/mg.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
G8F4F8 (Q23-N166)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Accession # G8F4F8 -
His REG1A (Q23-N166)
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG1A; Regenerating Protein I Alpha; Prev. REG; Lithostathine-1-Alpha; PSPS1; REG-1-Alpha; PSPS; ICRF; PSP; Regenerating Islet-Derived 1 Alpha (Pancreatic Stone Protein, Pancreatic Thread Protein); PTP; Pancreatic Stone Protein, Secretory; Pancreatic Thre
-
AA Sequence
QEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLVSYKSWDIGAPNSVNPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN
-
Molecular Weight
Approximately 19 kDa & 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
