REG4 Protein, Mouse (His)
REG4 protein, a calcium-independent lectin, binds specifically to mannose and maintains carbohydrate recognition in acidic environments. It is implicated in the inflammatory and metaplastic responses of the gastrointestinal epithelium. REG4 Protein, Mouse (His) is the recombinant mouse-derived REG4 protein, expressed by E. coli , with C-10*His tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG4 protein, a calcium-independent lectin, binds specifically to mannose and maintains carbohydrate recognition in acidic environments. It is implicated in the inflammatory and metaplastic responses of the gastrointestinal epithelium. REG4 Protein, Mouse (His) is the recombinant mouse-derived REG4 protein, expressed by E. coli , with C-10*His tag.
Background
REG4 protein is a calcium-independent lectin that exhibits a specific binding affinity for mannose and retains its ability to recognize carbohydrates even in acidic environments. It is believed to play a role in the inflammatory and metaplastic responses of the gastrointestinal epithelium.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-10*His
-
Accession
NP_080604.2/Q9D8G5 (D23-T157)
-
Molecular Construction
-
N-term
-
REG4 (D23-T157)
Accession # NP_080604.2/Q9D8G5 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG4; Regenerating Islet-Derived Protein IV; Regenerating Family Member 4; Regenerating Islet-Derived Protein 4; RELP; Regenerating Gene Type IV; GISP; REG-Like Protein; Gastrointestinal Secretory Protein; Reg IV; REG-IV; REG-4; Regenerating Islet-Derived
-
AA Sequence
DILRPSCAPGWFYYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNQKEASVISKYITGYQRNLPVWIGLHDPQKKQLWQWTDGSTNLYRRWNPRTKSEARHCAEMNPKDKFLTWNKNGCANRQHFLCKYKT
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 300 - 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
