REG4 Protein, Mouse (His)

REG4 protein, a calcium-independent lectin, binds specifically to mannose and maintains carbohydrate recognition in acidic environments. It is implicated in the inflammatory and metaplastic responses of the gastrointestinal epithelium. REG4 Protein, Mouse (His) is the recombinant mouse-derived REG4 protein, expressed by E. coli , with C-10*His tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

REG4 protein, a calcium-independent lectin, binds specifically to mannose and maintains carbohydrate recognition in acidic environments. It is implicated in the inflammatory and metaplastic responses of the gastrointestinal epithelium. REG4 Protein, Mouse (His) is the recombinant mouse-derived REG4 protein, expressed by E. coli , with C-10*His tag.

Background

REG4 protein is a calcium-independent lectin that exhibits a specific binding affinity for mannose and retains its ability to recognize carbohydrates even in acidic environments. It is believed to play a role in the inflammatory and metaplastic responses of the gastrointestinal epithelium.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • REG4 (D23-T157)
      Accession # NP_080604.2/Q9D8G5
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    REG4; Regenerating Islet-Derived Protein IV; Regenerating Family Member 4; Regenerating Islet-Derived Protein 4; RELP; Regenerating Gene Type IV; GISP; REG-Like Protein; Gastrointestinal Secretory Protein; Reg IV; REG-IV; REG-4; Regenerating Islet-Derived

  • AA Sequence

    DILRPSCAPGWFYYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNQKEASVISKYITGYQRNLPVWIGLHDPQKKQLWQWTDGSTNLYRRWNPRTKSEARHCAEMNPKDKFLTWNKNGCANRQHFLCKYKT

  • Predicted Molecular Mass

    17.5 kDa

  • Molecular Weight

    Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 300 - 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00