REG4 Protein, Rat (HEK293, Fc)
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The REG4 protein is a calcium-dependent lectin that functions as a pattern recognition receptor (PRR) in the innate immune system. REG4 has specific affinity for α-mannan on Candida albicans hyphae and triggers phosphorylation of the FCER1G immunoreceptor tyrosine activation motif (ITAM), thereby activating SYK, CARD9 and NF-kappa-B. REG4 Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG4 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Dectin-2/CLEC6A, a calcium-dependent lectin, serves as a pattern recognition receptor (PRR) in the innate immune system, with a specific affinity for alpha-mannans present on C.albicans hyphae. Upon binding, this receptor complex triggers the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation sequence leads to the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, Dectin-2/CLEC6A recognizes allergens from house dust mite and fungi in a mannose-dependent manner, promoting cysteinyl leukotriene production. It also plays a role in altering adaptive immune responses by recognizing soluble elements from the eggs of Shistosoma mansoni. Associated with FCER1G, it forms a heterodimer with CLEC4D, creating a PRR against fungal infection.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q68AX7 (D23-P157)
-
Molecular Construction
-
N-term
-
REG4 (D23-P157)
Accession # Q68AX7 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG4; Regenerating Islet-Derived Protein IV; Regenerating Family Member 4; Regenerating Islet-Derived Protein 4; RELP; Regenerating Gene Type IV; GISP; REG-Like Protein; Gastrointestinal Secretory Protein; Reg IV; REG-IV; REG-4; Regenerating Islet-Derived
-
AA Sequence
DILRPSCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSLPVWIGLHDPQKNASWQWIDGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTWNKNGCTKRQHFLCKYRP
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
