RGM-C Protein, Human (HEK293, His)
RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (HEK293, His) is the recombinant human-derived RGM-C protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (HEK293, His) is the recombinant human-derived RGM-C protein, expressed by HEK293 , with C-His labeled tag.
Background
RGM-C operates as a bone morphogenetic protein (BMP) coreceptor, contributing to the modulation of BMP signaling and playing a crucial role in the regulation of hepcidin (HAMP) expression, thereby influencing iron homeostasis. This protein interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a network of molecular associations that collectively contribute to its role in mediating BMP-related signaling pathways and iron regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q6ZVN8-1 (Q36-D400)
-
Molecular Construction
-
N-term
-
RGM-C (Q36-D400)
Accession # Q6ZVN8-1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
HJV; Haemojuvelin; Prev. HFE2; JH; Hemojuvelin; Hemochromatosis Type 2 (Juvenile); RGMC; Hemochromatosis Type 2 Protein; RGM Domain Family Member C; Repulsive Guidance Molecule C; Hemojuvelin BMP Coreceptor; Hemojuvelin BMP Co-Receptor; HFE2A
-
AA Sequence
QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 50-60 kDa (mature) & 30-40 kDa (C-terminus chain) & 20-25 kDa (N-terminus chain), based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
