RIZ1 Protein, Human (His)

RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (His) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of RIZ1 Protein, Human (His) is 200 a.a., with molecular weight of ~27 kDa.

RIZ1 protein serves as an S-adenosyl-L-methionine-dependent histone methyltransferase, demonstrating specificity in methylating 'Lys-9' of histone H3. Beyond its histone modification role, RIZ1 may also function as a DNA-binding transcription factor, with an affinity for the macrophage-specific TPA-responsive element (MTE) within the HMOX1 (heme oxygenase 1) gene. In this context, it is implicated as a potential transcriptional activator for HMOX1, suggesting a regulatory role in the expression of this gene.

Data is not available.

Human

E. coli

N-6*His

Q13029 (M1-A200)

7799  [NCBI]

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.