RNF182 Protein, Human (His)
Based on 1 Customer Validation
RNF182 Protein, Human (His) is the recombinant human-derived RNF182 protein, expressed by E. coli, with C-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RNF182 Protein, Human (His) is the recombinant human-derived RNF182 protein, expressed by E. coli, with C-6*His tag.
RNF182 is an E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C, targeting it for degradation via the ubiquitin-proteasome pathway. Additionally, it plays a role in inhibiting TLR-triggered innate immune responses by mediating 'Lys'-48-linked ubiquitination and subsequent degradation of the NF-kappa-B component RELA.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q8N6D2 (M1-R183)
-
Gene ID221687
-
Molecular Construction
-
N-term
-
RNF182 (M1-R183)
Accession # Q8N6D2 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
RNF182; E3 Ubiquitin-Protein Ligase RNF182; Ring Finger Protein 182; RING Finger Protein 182; RING-Type E3 Ubiquitin Transferase RNF182; MGC33993
-
AA Sequence
MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIR
-
Predicted Molecular Mass
27.3 kDa
-
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
