S100B Protein, Canine (HEK293, Fc)

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities. Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both. S100B Protein, Canine (HEK293, Fc) is the recombinant canine-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities. Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both. S100B Protein, Canine (HEK293, Fc) is the recombinant canine-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.

Background

S100B, a small zinc- and calcium-binding protein highly expressed in astrocytes and abundant in the brain, possesses distinct binding sites for calcium and zinc with varying affinities. While weakly binding calcium, it exhibits tight binding to zinc. Physiological concentrations of potassium ion can antagonize the binding of both divalent cations, particularly affecting high-affinity calcium-binding sites. Functionally, S100B acts as a neurotrophic factor, promoting astrocytosis and axonal proliferation. It also plays a role in the innervation of thermogenic adipose tissue, acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation. S100B initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Post-myocardial infarction, its interaction with AGER may contribute to myocyte apoptosis through the activation of ERK1/2 and p53/TP53 signaling. Additionally, S100B could aid in ATAD3A cytoplasmic processing, preventing aggregation and facilitating mitochondrial localization. Its role extends to mediating calcium-dependent regulation in various physiological processes by interacting with proteins like TPR-containing proteins, modulating their activity. Structurally, S100B forms dimers composed of either two alpha chains, two beta chains, or one alpha and one beta chain, interacting with a multitude of proteins, including CACYBP, ATAD3A, S100A6, CAPZA1, PPP5C, TPPP, and CLSTN3beta, influencing diverse cellular functions.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • S100B (S2-E92)
      Accession # E2QTP3
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100B; S100 Calcium-Binding Protein B; S100 Calcium Binding Protein B; S100 Calcium-Binding Protein; S100beta; S-100 Protein Beta Chain; S-100 Protein Subunit Beta; Protein S100; Protein S100-B; S100-B; S100 Calcium Binding Protein, Beta (Neural); S100; S

  • AA Sequence

    SQLEKAALALLDVFQQYSARAGGGRRLRKADVKELIGSELAHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFVAFVAMVTTACHEFFEHE

  • Predicted Molecular Mass

    36.5 kDa

  • Molecular Weight

    Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00