SARS-CoV-2 PLpro Protein

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free.

Background

The SARS-CoV-2 PP1ab protein is a multifunctional component crucial for the transcription and replication of viral RNAs, housing the proteinases responsible for polyprotein cleavages. This protein plays a pivotal role in inhibiting host translation by associating with the open head conformation of the 40S subunit, and its C-terminus obstructs the ribosomal mRNA entry tunnel, thereby impeding the antiviral response triggered by innate immunity or interferons. The formation of the nsp1-40S ribosome complex leads to an endonucleolytic cleavage near the 5'UTR of host mRNAs, facilitating their degradation. Notably, viral mRNAs exhibit greater resistance to the nsp1-mediated inhibition of translation due to their 5'-end leader sequence. This multifaceted functionality underscores the strategic role of SARS-CoV-2 PP1ab in manipulating host cellular processes for the benefit of viral replication and evasion of host defenses.

Verified Bioactivity

PLpro/papain-like protease(Plpro) can hydrolyze Arg-Leu-Arg-Gly-Gly-AMC to produce AMC, and the activity of PLpro is calculated by measuring the amount of product AMC produced at the excitation wavelength of 380nm and the emission wavelength of 460nm. The specific activity is 124.43pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SARS-CoV-2 Plpro (E1564-K1878)
      Accession # P0DTD1-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rReplicase polyprotein 1ab/2019-nCoV Papain-Like Protease; Papain-like Protease; PLpro; PL-PRO; pp1a; Replicase polyprotein 1a

  • AA Sequence

    EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK

  • Predicted Molecular Mass

    35.8 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 10 mM 2-Mercaptoethanol, 20% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00