SARS-CoV-2 PLpro Protein
Based on 1 publication(s) in Google Scholar
The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free.
Background
The SARS-CoV-2 PP1ab protein is a multifunctional component crucial for the transcription and replication of viral RNAs, housing the proteinases responsible for polyprotein cleavages. This protein plays a pivotal role in inhibiting host translation by associating with the open head conformation of the 40S subunit, and its C-terminus obstructs the ribosomal mRNA entry tunnel, thereby impeding the antiviral response triggered by innate immunity or interferons. The formation of the nsp1-40S ribosome complex leads to an endonucleolytic cleavage near the 5'UTR of host mRNAs, facilitating their degradation. Notably, viral mRNAs exhibit greater resistance to the nsp1-mediated inhibition of translation due to their 5'-end leader sequence. This multifaceted functionality underscores the strategic role of SARS-CoV-2 PP1ab in manipulating host cellular processes for the benefit of viral replication and evasion of host defenses.
Verified Bioactivity
PLpro/papain-like protease(Plpro) can hydrolyze Arg-Leu-Arg-Gly-Gly-AMC to produce AMC, and the activity of PLpro is calculated by measuring the amount of product AMC produced at the excitation wavelength of 380nm and the emission wavelength of 460nm. The specific activity is 124.43pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Ethnopharmacol
Multi-target mechanisms against coronaviruses of constituents from Chinese Dagang Tea revealed by experimental and docking studies. [Abstract]2022 Oct 28:297:115528. PMID: 35835344
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag Tag Free
-
Accession
P0DTD1-1/YP_009724389.1 (E1564-K1878)
-
Gene ID43740578 [NCBI]
-
Molecular Construction
-
N-term
-
SARS-CoV-2 Plpro (E1564-K1878)
Accession # P0DTD1-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
rReplicase polyprotein 1ab/2019-nCoV Papain-Like Protease; Papain-like Protease; PLpro; PL-PRO; pp1a; Replicase polyprotein 1a
-
AA Sequence
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 10 mM 2-Mercaptoethanol, 20% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)