SARS-COV-2 S1 Protein NTD (HEK293, His-Flag)

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-COV-2 S1 Protein NTD (HEK293, His-Flag) is the recombinant Virus-derived SARS-COV-2 S1 protein NTD, expressed by HEK293 , with C-His, C-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-COV-2 S1 Protein NTD (HEK293, His-Flag) is the recombinant Virus-derived SARS-COV-2 S1 protein NTD, expressed by HEK293 , with C-His, C-Flag labeled tag.

Background

The SARS-CoV-2 S1 Protein plays a crucial role in the early stages of viral infection. Spike protein S1 facilitates the attachment of the virion to the cell membrane by interacting with host receptors, thereby initiating the infection process. This initial binding event is pivotal for the subsequent entry of the virus into the host cell. Concurrently, Spike protein S2', serving as a viral fusion peptide, comes into play after S2 cleavage during virus endocytosis. The unmasking of S2' is a key step in the viral fusion process, enabling the merging of the viral membrane with the endosomal membrane and facilitating the release of the viral genetic material into the host cell cytoplasm. The concerted action of these S1 and S2' functionalities underscores the significance of the SARS-CoV-2 S1 Protein in mediating viral entry and fusion, crucial steps in the viral life cycle.

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-8*His;C-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • S1 Protein (V16-S305)
      Accession # P0DTC2/QHD43416.1
    • 8*His-Flag
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    S1 protein NTD,Spike glycoprotein Subunit1 NTD,S glycoprotein Subunit1 NTD,Spike protein S1 NTD

  • AA Sequence

    VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS

  • Predicted Molecular Mass

    35 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00