SARS-CoV S Protein RBD (Biotinylated, sf9, His)

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. It down-regulates host tetherin (BST2) via lysosomal degradation, countering its antiviral activity. Following attachment, internalization into host cell endosomes induces S glycoprotein conformational changes, potentially unmasking the fusion peptide of S2 through cathepsin CTSL proteolysis. S protein also impairs target cell killing and cytokine production[1][2].

Technical Parameters

  • Species Virus
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SARS-CoV S (R306-F527)
      Accession # AAX16192.1
    • His
    • C-term
  • Protein Length

    Partial

  • Conjugation

    Biotin

  • Synonyms

    2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD

  • AA Sequence

    RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

  • Predicted Molecular Mass

    26.5 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00