1. Recombinant Proteins
  2. Viral Proteins Biotinylated Proteins
  3. SARS-CoV S Protein RBD (Biotinylated, sf9, His)

SARS-CoV S Protein RBD (Biotinylated, sf9, His)

Cat. No.: HY-P76019
Handling Instructions Technical Support

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. It down-regulates host tetherin (BST2) via lysosomal degradation, countering its antiviral activity. Following attachment, internalization into host cell endosomes induces S glycoprotein conformational changes, potentially unmasking the fusion peptide of S2 through cathepsin CTSL proteolysis. S protein also impairs target cell killing and cytokine production[1][2].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

AAX16192 (R306-F527)

Gene ID

/

Molecular Construction
N-term
SARS-CoV S (R306-F527)
Accession # AAX16192
His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Predicted Molecular Mass
26.5 kDa
분자량

Approximately 35.1 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

SARS-CoV S Protein RBD (Biotinylated, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

SARS-CoV S Protein RBD (Biotinylated, sf9, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
SARS-CoV S Protein RBD (Biotinylated, sf9, His)
Cat. No.:
HY-P76019
수량:
MCE Japan Authorized Agent: