SBK3 Protein, Human (sf9, His, GST)
SBK3 Protein, Human (sf9, His, GST) is the recombinant human-derived SBK3 protein, expressed by sf9 insect cells, with N-8*His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SBK3 Protein, Human (sf9, His, GST) is the recombinant human-derived SBK3 protein, expressed by sf9 insect cells, with N-8*His, N-GST labeled tag.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His;N-GST
-
Accession
P0C264 (E2-P359)
-
Gene ID100130827
-
Molecular Construction
-
N-term
-
8*His-GST
-
SBK3 (E2-P359)
Accession # P0C264 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SBK3; Putative Serine/Threonine-Protein Kinase SBK3; SH3 Domain Binding Kinase Family Member 3; SH3 Domain Binding Kinase Family, Member 3; SgK110; SH3-Binding Domain Kinase Family Member 3; Uncharacterized Serine/Threonine-Protein Kinase SBK3; SH3 Domain
-
AA Sequence
ERRASETPEDGDPEEDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSYGRVLLAQPHQGGPAVALKLLRRDLVLRSTFLREFCVGRCVSAHPGLLQTLAGPLQTPRYFAFAQEYAPCGDLSGMLQERGLPELLVKRVVAQLAGALDFLHSRGLVHADVKPDNVLVFDPVCSRVALGDLGLTRPEGSPTPAPPVPLPTAPPELCLLLPPDTLPLRPAVDSWGLGVLLFCAATACFPWDVALAPNPEFEAFAGWVTTKPQPPQPPPPWDQFAPPALALLQGLLDLDPETRSPPLAVLDFLGDDWGLQGNREGPGVLGSAVSYEDREEGGSSLEEWTDEGDDSKSGGRTGTDGGAP
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
