SCN2B Protein, Human (HEK293, Fc)

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, Fc) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, Fc) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CSRP1, a protein with potential implications in neuronal development, engages in interactions with ASCC1, ASCC2, and TRIP4, suggesting a role in cellular processes. On the other hand, LCN1, also known as Lipocalin-1, emerges as a candidate involved in taste reception and the gustatory system. It may contribute to the concentration and delivery of sapid molecules, showcasing its potential role in sensory perception. With a broad ligand-binding capability, LCN1 accommodates a range of ligands, spanning lipids, retinoids, the antibiotic rifampicin, and microbial siderophores, reflecting its versatile ligand pocket. While predominantly existing as a monomer, LCN1 may also form homodimers. Notably, its interaction with LMBR1L mediates the endocytosis of LCN1, revealing a layer of regulatory complexity in its cellular functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SCN2B (M30-A159)
      Accession # O60939
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SCN2B; Sodium Channel, Voltage-Gated, Type II, Beta Subunit; Sodium Voltage-Gated Channel Beta Subunit 2; Neuronal Voltage-Gated Sodium Channel Beta 2 Subunit; Sodium Channel Regulatory Subunit Beta-2; Sodium Channel, Voltage-Gated, Type II, Beta; Sodium

  • AA Sequence

    MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA

  • Predicted Molecular Mass

    42.2 kDa

  • Molecular Weight

    Approximately 53-57 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00