1. Recombinant Proteins
  2. Others
  3. SDC4 Protein, Mouse (HEK293, Fc)

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Syndecan-4 (SDC4) is a cell surface proteoglycan that plays a crucial role in regulating exosome biogenesis in collaboration with SDCBP and PDCD6IP. As a homodimer, SDC4 engages in various protein interactions, including binding with CDCP1 and SDCBP, suggesting its involvement in diverse cellular processes. Through its cytoplasmic domain, SDC4 forms interactions with GIPC, specifically through the PDZ domain, and with NUDT16L1. These associations highlight the multifunctional nature of SDC4, suggesting its participation in intricate cellular signaling pathways and the regulation of exosome dynamics.

Biological Activity

1.Measured by its binding ability in a functional ELISA.Immobilized human MDK at 10 μg/mL (100 μl/well) can bind mouse SDC4-Fc with a linear range of 0.16-1.25 μg/mL.
2.Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 104 cells/well are added to mouse Syndecan-4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED50 for this effect is 2.984 μg/mL, corresponding to a specific activity is 3.35×102 U/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 104 cells/well are added to mouse Syndecan-4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED50 for this effect is 2.984 μg/mL, corresponding to a specific activity is 3.35×102 U/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O35988 (E24-V146)

Gene ID
Molecular Construction
N-term
SDC4 (E24-V146)
Accession # O35988
hFc
C-term
Protein Length

Partial

Synonyms
SDC4; Syndecan-4; SYND4; Ryudocan core protein
AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV

분자량

Approximately 50-55 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

SDC4 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

SDC4 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
SDC4 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73424
수량:
MCE Japan Authorized Agent: