SDPR Protein, Mouse (His)
SDPR proteins complexly regulate caveolae biogenesis and morphology, inducing membrane curvature of specialized caveolae.Tissue-wise, it is critical for caveolae in lung and fat endothelial cells, but not in cardiac endothelial cells.SDPR Protein, Mouse (His) is the recombinant mouse-derived SDPR protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SDPR proteins complexly regulate caveolae biogenesis and morphology, inducing membrane curvature of specialized caveolae.Tissue-wise, it is critical for caveolae in lung and fat endothelial cells, but not in cardiac endothelial cells.SDPR Protein, Mouse (His) is the recombinant mouse-derived SDPR protein, expressed by E.coli , with N-His labeled tag.
The SDPR protein is intricately involved in caveolar biogenesis and morphology, serving as a key regulator of caveolae structure by inducing membrane curvature within these specialized membrane invaginations. Its role in caveola formation exhibits tissue-specific characteristics, being essential for caveolae development in the lung and fat endothelia but not in the heart endothelia. In lung endothelial cells, SDPR acts as a negative regulator of the size or stability of CAVIN complexes. Additionally, it may play a role in targeting PRKCA to caveolae and forms a crucial component of the CAVIN complex alongside CAVIN1, CAVIN2, CAVIN3, and CAVIN4. SDPR's interactions with PRKCA, CAVIN4, CAVIN1, and CAV3 underscore its multifaceted involvement in caveolar dynamics, shedding light on its significance in the regulation of cellular membrane structures and associated signaling pathways.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
Q63918 (G2-A180)
-
Gene ID20324 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
SDPR (G2-A180)
Accession # Q63918 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Caveolae-associated protein 2; Cavin-2; Phosphatidylserine-binding protein; SDR
-
AA Sequence
GEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAA
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
