1. Recombinant Proteins
  2. Others
  3. SDPR Protein, Mouse (His)

SDPR proteins complexly regulate caveolae biogenesis and morphology, inducing membrane curvature of specialized caveolae.Tissue-wise, it is critical for caveolae in lung and fat endothelial cells, but not in cardiac endothelial cells.SDPR Protein, Mouse (His) is the recombinant mouse-derived SDPR protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SDPR proteins complexly regulate caveolae biogenesis and morphology, inducing membrane curvature of specialized caveolae.Tissue-wise, it is critical for caveolae in lung and fat endothelial cells, but not in cardiac endothelial cells.SDPR Protein, Mouse (His) is the recombinant mouse-derived SDPR protein, expressed by E.coli , with N-His labeled tag.

Background

The SDPR protein is intricately involved in caveolar biogenesis and morphology, serving as a key regulator of caveolae structure by inducing membrane curvature within these specialized membrane invaginations. Its role in caveola formation exhibits tissue-specific characteristics, being essential for caveolae development in the lung and fat endothelia but not in the heart endothelia. In lung endothelial cells, SDPR acts as a negative regulator of the size or stability of CAVIN complexes. Additionally, it may play a role in targeting PRKCA to caveolae and forms a crucial component of the CAVIN complex alongside CAVIN1, CAVIN2, CAVIN3, and CAVIN4. SDPR's interactions with PRKCA, CAVIN4, CAVIN1, and CAV3 underscore its multifaceted involvement in caveolar dynamics, shedding light on its significance in the regulation of cellular membrane structures and associated signaling pathways.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q63918 (G2-A180)

Gene ID

20324  [NCBI]

Molecular Construction
N-term
His
SDPR (G2-A180)
Accession # Q63918
C-term
Protein Length

Partial

Synonyms
Caveolae-associated protein 2; Cavin-2; Phosphatidylserine-binding protein; SDR
AA Sequence

GEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAA

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SDPR Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SDPR Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDPR Protein, Mouse (His)
Cat. No.:
HY-P76637
Quantity:
MCE Japan Authorized Agent: