Copy Link Print Information

PEDF/Serpin F1 Protein, Human (HEK293, N-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. PEDF/Serpin F1 Protein, Human (HEK293, N-His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PEDF/Serpin F1 Protein, Human (HEK293, N-His)
  • Experimental Validation Results for PEDF/Serpin F1 Protein, Human (HEK293, N-His)
  • PEDF/Serpin F1 Protein, Human (HEK293, N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. PEDF/Serpin F1 Protein, Human (HEK293, N-His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

Neurotrophic protein Serpin F1 plays a pivotal role in promoting extensive neuronal differentiation in retinoblastoma cells. Additionally, it functions as a potent inhibitor of angiogenesis. Notably, Serpin F1 does not undergo the S (stressed) to R (relaxed) conformational transition typical of active serpins, resulting in the absence of serine protease inhibitory activity. Furthermore, it interacts with PNPLA2, fostering the phospholipase A2 activity of PNPLA2.

Verified Bioactivity

Measured by its ability to enhance the adhesion of Saos-2 human osteosarcoma cells to bovine Collagen I coated plate. The ED50 this effect is 0.2506 μg/mL, corresponding to a specific activity is 3.99×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance the adhesion of Saos-2 human osteosarcoma cells to bovine Collagen I coated plate. The ED50 for this effect is 0.2506 μg/mL, corresponding to a specific activity is 3.99×103 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession

    P36955 (Q20-P418)

  • Gene ID
    5176  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • Serpin F1 (Q20-P418)
      Accession # P36955
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SERPINF1; Testis Tissue Sperm-Binding Protein Li 70n; Prev. PEDF; Serpin Peptidase Inhibitor, Clade F (Alpha-2 Antiplasmin, Pigment Epithelium Derived Factor), Member 1; EPC-1; Proliferation-Inducing Protein 35; Pigment Epithelium-Derived Factor; Serpin F

  • AA Sequence

    QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

  • Predicted Molecular Mass

    45.2 kDa

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to enhance the adhesion of Saos-2 human osteosarcoma cells to bovine Collagen I coated plate. The ED50 for this effect is 0.2506 μg/mL, corresponding to a specific activity is 3.99×103 units/mg.

  • PEDF/Serpin F1 Protein, Human (HEK293, N-His) Product Image
    1/16
  • Experimental Validation Results for PEDF/Serpin F1 Protein, Human (HEK293, N-His)
  • Experimental Validation Results for PEDF/Serpin F1 Protein, Human (HEK293, N-His)
  • PEDF/Serpin F1 Protein, Human (HEK293, N-His) Product Image