Serum amyloid A protein, Cat (P.pastoris, His)
Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Cat
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.
Background
Serum Amyloid A Protein emerges as a key player in the acute phase response, serving as a major acute phase reactant. Its dynamic role extends to functioning as an essential apolipoprotein within the high-density lipoprotein (HDL) complex. During acute phase reactions, the heightened expression of Serum Amyloid A reflects its integral involvement in the body's adaptive response to diverse physiological challenges. Additionally, its role as an apolipoprotein emphasizes its contribution to the regulation of lipid metabolism, underscoring the multifaceted nature of Serum Amyloid A in maintaining homeostasis and responding to inflammatory stimuli.
Technical Parameters
-
Species Cat
-
Source P. pastoris
-
Tag N-His
-
Accession
P19707 (E1-G90)
-
Gene ID101099498
-
Molecular Construction
-
N-term
-
His
-
SAA1 (E1-G90)
Accession # P19707 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SAA1; PIG4; Prev. SAA; Serum Amyloid A Protein; TP53I4; Tumor Protein P53 Inducible Protein 4; Serum Amyloid A1; Serum Amyloid A-1 Protein
-
AA Sequence
EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
-
Predicted Molecular Mass
12.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
