Serum amyloid A protein, Cat (P.pastoris, His)

Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.

Serum Amyloid A Protein emerges as a key player in the acute phase response, serving as a major acute phase reactant. Its dynamic role extends to functioning as an essential apolipoprotein within the high-density lipoprotein (HDL) complex. During acute phase reactions, the heightened expression of Serum Amyloid A reflects its integral involvement in the body's adaptive response to diverse physiological challenges. Additionally, its role as an apolipoprotein emphasizes its contribution to the regulation of lipid metabolism, underscoring the multifaceted nature of Serum Amyloid A in maintaining homeostasis and responding to inflammatory stimuli.

Cat

P. pastoris

N-His

P19707 (E1-G90)

101099498

Partial

EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.