SFRP2 Protein, Cynomolgus (HEK293, His)

The SFRP2 protein belongs to the secreted Frizzled-related protein (sFRP) family and regulates the Wnt signaling pathway and cellular processes. Notably, SFRP2 lacks conserved residues that are critical for feature annotation propagation, suggesting that the sFRP family has unique structural or functional properties. SFRP2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

The SFRP2 Protein is a member of the secreted frizzled-related protein (sFRP) family, indicating its involvement in modulating Wnt signaling pathways and cellular processes. However, it is noteworthy that SFRP2 lacks conserved residue(s) required for the propagation of feature annotation. This suggests unique structural characteristics or functional properties within the sFRP family, highlighting the distinctiveness of SFRP2 in comparison to other family members. The study of SFRP2 contributes to our understanding of its specific functions and interactions within the context of Wnt signaling, shedding light on potential variations in its regulatory mechanisms. Further exploration of SFRP2's role, especially regarding the absence of conserved residues, holds promise for enhancing our knowledge of its contributions to developmental processes and disease pathways influenced by Wnt signaling.

Cynomolgus

HEK293

C-8*His

G8F2Z7 (L25-C295)

102147309  [NCBI]

Full Length of Mature Protein

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Approximately 33-38 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.