1. Recombinant Proteins
  2. Others
  3. SFRP2 Protein, Cynomolgus (HEK293, His)

The SFRP2 protein belongs to the secreted Frizzled-related protein (sFRP) family and regulates the Wnt signaling pathway and cellular processes. Notably, SFRP2 lacks conserved residues that are critical for feature annotation propagation, suggesting that the sFRP family has unique structural or functional properties. SFRP2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SFRP2 protein belongs to the secreted Frizzled-related protein (sFRP) family and regulates the Wnt signaling pathway and cellular processes. Notably, SFRP2 lacks conserved residues that are critical for feature annotation propagation, suggesting that the sFRP family has unique structural or functional properties. SFRP2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The SFRP2 Protein is a member of the secreted frizzled-related protein (sFRP) family, indicating its involvement in modulating Wnt signaling pathways and cellular processes. However, it is noteworthy that SFRP2 lacks conserved residue(s) required for the propagation of feature annotation. This suggests unique structural characteristics or functional properties within the sFRP family, highlighting the distinctiveness of SFRP2 in comparison to other family members. The study of SFRP2 contributes to our understanding of its specific functions and interactions within the context of Wnt signaling, shedding light on potential variations in its regulatory mechanisms. Further exploration of SFRP2's role, especially regarding the absence of conserved residues, holds promise for enhancing our knowledge of its contributions to developmental processes and disease pathways influenced by Wnt signaling.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

G8F2Z7 (L25-C295)

Gene ID
Molecular Construction
N-term
SFRP2 (L25-C295)
Accession # G8F2Z7
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
sFRP-2; SARP-1; Sarp1; Sdf5; Sfrp2
AA Sequence

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Predicted Molecular Mass
32.2 kDa
Molecular Weight

Approximately 33-38 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SFRP2 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SFRP2 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SFRP2 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700823
Quantity:
MCE Japan Authorized Agent: