SFRP2 Protein, Human (HEK293, His, solution)

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His, solution) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Secreted frizzled-related protein 2 (SFRP2) is a soluble frizzled-related protein that activates the Wnt/β-catenin signaling pathway through DNA demethylation regulation. SFRP2 contains a cysteine-rich domain that is a soluble regulator of Wnt signaling. SFRP2 can differentiate human induced pluripotent stem cells into mature cardiomyocytes. Overexpression of SFRP2 induces osteoblast-like phenotype in prostate cancer cells. SFRP2 promotes carcinogenesis and radiation resistance of glioma cells by activating the Wnt/β-catenin signaling pathway. SFRP2 promoter is hypermethylated in a variety of malignancies and overexpressed in a variety of tumor cells, which may be associated with tumorigenesis. SFRP2 can be used as a non-invasive biomarker for HBV-associated hepatocellular carcinoma^{[1][2][3][4][5]}.

Human

HEK293

C-8*His

Q96HF1 (L25-C295)

6423  [NCBI]

Full Length of Mature Protein

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

34-38 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM PBS, 100 mM Larginine, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.