SFTPC Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
SFTPC Protein, Human (P.pastoris, His) is the recombinant human-derived SFTPC protein, expressed by P. pastoris, with N-6*His tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SFTPC Protein, Human (P.pastoris, His) is the recombinant human-derived SFTPC protein, expressed by P. pastoris, with N-6*His tag.
Background
SFTPC is a pulmonary surfactant associated protein that promotes alveolar stability by reducing the surface tension at the air-liquid interface in the peripheral air spaces.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P11686-1 (F24-L58)
-
Gene ID6440
-
Molecular Construction
-
N-term
-
6*His
-
SFTPC (F24-L58)
Accession # P11686-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SFTPC; SMDP2; Prev. SFTP2; BRICHOS Domain Containing 6; SP-C; Surfactant, Pulmonary-Associated Protein C; Pulmonary Surfactant-Associated Proteolipid SPL(Val); Pulmonary Surfactant Apoprotein-2 SP-C; BRICD6; SP5; PSP-C; Surfactant Protein C; Pulmonary Sur
-
AA Sequence
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
-
Predicted Molecular Mass
5.7 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
