Siglec-3/CD33 Protein, Human (HEK293, His)

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Human (HEK293, His) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Human (HEK293, His) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-His labeled tag.

Background

Siglec-3/CD33, a sialic-acid-binding immunoglobulin-like lectin, plays a crucial role in mediating cell-cell interactions and maintaining immune cells in a resting state. It exhibits a preference for binding sialic acid on the short O-linked glycans of specific mucins. The protein forms homodimers through disulfide linkages and interacts with signaling molecules such as PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. Additionally, CD33 engages with C1QA via its C-terminus, leading to the activation of CD33 inhibitory motifs.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD33 (D18-H259)
      Accession # AAH28152
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD33; Myeloid Cell Surface Antigen CD33; CD33 Molecule; FLJ00391; SIGLEC3; Gp67; CD33 Antigen (Gp67); CDNA FLJ50122, Highly Similar To Myeloid Cell Surface Antigen CD33; CD33rSiglec; Sialic Acid Binding Ig-Like Lectin 3; SIGLEC-3; CD33 Molecule Transcript

  • AA Sequence

    DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

  • Predicted Molecular Mass

    28.2 kDa

  • Molecular Weight

    Approximately 40-46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00