SIRP alpha/CD172a Protein, Mouse (BAA20376, HEK293, Fc)
Based on 1 Customer Validation
The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (BAA20376, HEK293, Fc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (BAA20376, HEK293, Fc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SIRP alpha/CD172a Protein functions as an immunoglobulin-like cell surface receptor for CD47, facilitating the translocation of PTPN6, PTPN11, and other binding partners from the cytosol to the plasma membrane. This receptor plays a crucial role in various cellular processes, including supporting adhesion of cerebellar neurons, promoting neurite outgrowth, and facilitating glial cell attachment. Additionally, SIRP alpha/CD172a is implicated in intracellular signaling during synaptogenesis and synaptic function. Its negative regulatory role extends to receptor tyrosine kinase-coupled responses induced by cell adhesion, growth factors, or insulin. Furthermore, SIRP alpha/CD172a participates in the negative modulation of phagocytosis, mast cell activation, and dendritic cell activation, with CD47 binding preventing dendritic cell maturation and inhibiting cytokine production. Notably, it contributes to antiviral immunity by limiting new world arenavirus infection, specifically by decreasing virus internalization. The receptor also interacts with THBS1, participating in ROS signaling in non-phagocytic cells and stimulating NADPH oxidase-derived ROS production. SIRP alpha/CD172a engages in diverse protein interactions, including binding to PTPN11, GRB2, FGR, JAK2, SCAP1, SCAP2, FYB1, PTK2B, and TRIM2.
Verified Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized rat CD47-His at 10 μg/mL (100 μl/well) can bind mouse SIRPA-Fc, The EC50 of mouse SIRPA-Fc is 0.6-1.4 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
BAA20376.1 (T32-N373)
-
Molecular Construction
-
N-term
-
CD172a (T32-N373)
Accession # BAA20376.1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SIRPA; MYD1; Prev. PTPNS1; Brain-Immunoglobulin-Like Molecule With Tyrosine-Based Activation Motifs; SHPS1; Brain Ig-Like Molecule With Tyrosine-Based Activation Motifs; SIRP; Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1; BIT; Tyrosine Phos
-
AA Sequence
TEVKVTQPEKSVSVAAGDSTILNCTVTSLLPVGPIRWYRGVGQSRLLIYSFTGEHFPRVRNVSDTTKRNNMDFSIRISNVTPEDAGTYYCVKFQRGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQPPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGLAHSSDQGSMQTFPGNNATHNWN
-
Predicted Molecular Mass
64.9 kDa
-
Molecular Weight
Approximately 1001-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)