SLC25A4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.

Background

SLC25A4 is an ADP:ATP antiporter that imports ADP into the mitochondrial matrix for ATP synthesis and exports ATP to fuel cellular processes. It cycles between cytoplasmic-open (c-state) and matrix-open (m-state) conformations via an alternating access mechanism, exposing a single substrate-binding site to either side of the inner mitochondrial membrane (By similarity). Beyond its ADP:ATP antiporter function, it participates in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. As a proton transporter, it uncouples proton flow from the electron transport chain and ATP synthase, reducing ATP production efficiency and inducing mitochondrial thermogenesis (By similarity). This proton transport activity is inhibited by ADP:ATP antiporter activity, positioning SLC25A4/ANT1 as a master regulator balancing ATP synthesis and thermogenesis (By similarity). Proton transport requires free fatty acids as cofactors but does not translocate them (By similarity). It also plays a key role in mPTP opening, though its exact role (pore component vs. regulator) remains unclear (By similarity). Independently of its antiporter activity, it promotes mitophagy by binding TIMM44 to inhibit TIMM23, thereby stabilizing PINK1 (By similarity).

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • SLC25A4 (G2-V298)
      Accession # P12235
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SLC25A4; ADP/ATP Carrier 1; Prev. ANT1; ADP,ATP Carrier Protein, Heart/Skeletal Muscle Isoform T1; Prev. PEO2; Adenine Nucleotide Translocator 1 (Skeletal Muscle); Prev. PEO3; ADP,ATP Carrier Protein, Heart/Skeletal Muscle; AAC1; Heart/Skeletal Muscle ATP

  • AA Sequence

    GDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

  • Predicted Molecular Mass

    34.4 kDa

  • Molecular Weight

    Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78,6% Trehalose, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00