SLC25A4 Protein, Human (His)
Based on 1 Customer Validation
SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SLC25A4 Protein, Human (His) is the recombinant human-derived SLC25A4 protein, expressed by E. coli cell-free system, with N-10*His tag.
Background
SLC25A4 is an ADP:ATP antiporter that imports ADP into the mitochondrial matrix for ATP synthesis and exports ATP to fuel cellular processes. It cycles between cytoplasmic-open (c-state) and matrix-open (m-state) conformations via an alternating access mechanism, exposing a single substrate-binding site to either side of the inner mitochondrial membrane (By similarity). Beyond its ADP:ATP antiporter function, it participates in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. As a proton transporter, it uncouples proton flow from the electron transport chain and ATP synthase, reducing ATP production efficiency and inducing mitochondrial thermogenesis (By similarity). This proton transport activity is inhibited by ADP:ATP antiporter activity, positioning SLC25A4/ANT1 as a master regulator balancing ATP synthesis and thermogenesis (By similarity). Proton transport requires free fatty acids as cofactors but does not translocate them (By similarity). It also plays a key role in mPTP opening, though its exact role (pore component vs. regulator) remains unclear (By similarity). Independently of its antiporter activity, it promotes mitophagy by binding TIMM44 to inhibit TIMM23, thereby stabilizing PINK1 (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P12235 (G2-V298)
-
Gene ID291
-
Molecular Construction
-
N-term
-
10*His
-
SLC25A4 (G2-V298)
Accession # P12235 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SLC25A4; ADP/ATP Carrier 1; Prev. ANT1; ADP,ATP Carrier Protein, Heart/Skeletal Muscle Isoform T1; Prev. PEO2; Adenine Nucleotide Translocator 1 (Skeletal Muscle); Prev. PEO3; ADP,ATP Carrier Protein, Heart/Skeletal Muscle; AAC1; Heart/Skeletal Muscle ATP
-
AA Sequence
GDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
-
Predicted Molecular Mass
34.4 kDa
-
Molecular Weight
Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78,6% Trehalose, pH7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)