SMAD3 Protein, Human/Mouse/Rat (GST)

The SMAD3 protein is an R-SMAD that acts as an intracellular signal transducer activated by TGF-β and activin type 1 receptor kinase.It binds TRE elements and regulates TGF-β target genes.SMAD3 Protein, Human/Mouse/Rat (GST) is the recombinant rat-derived SMAD3 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat; Mouse; Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The SMAD3 protein is an R-SMAD that acts as an intracellular signal transducer activated by TGF-β and activin type 1 receptor kinase.It binds TRE elements and regulates TGF-β target genes.SMAD3 Protein, Human/Mouse/Rat (GST) is the recombinant rat-derived SMAD3 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

Background

The SMAD3 protein serves as a receptor-regulated SMAD (R-SMAD), functioning as an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. It binds the TRE element in the promoter region of genes regulated by TGF-beta, and upon forming the SMAD3/SMAD4 complex, activates transcription. Additionally, SMAD3 can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. This protein plays a role in wound healing, potentially modulating the growth and migration of primary keratinocytes and altering TGF-mediated chemotaxis of monocytes, with its impact on wound healing being hormone-sensitive. SMAD3 also acts as a regulator of chondrogenesis and osteogenesis and inhibits the early healing of bone fractures. Furthermore, it positively regulates PDPK1 kinase activity by stimulating its dissociation from the negative regulator 14-3-3 protein YWHAQ. The protein exists as a monomer in the absence of TGF-beta and forms a homooligomer in its presence, or a heterotrimer with C-terminally phosphorylated SMAD2 or SMAD3 and SMAD4 to form the transcriptionally active SMAD2/SMAD3-SMAD4 complex. SMAD3 interacts with various proteins involved in diverse cellular processes, including signal transduction, transcriptional regulation, ubiquitination, and protein-protein interactions.

Technical Parameters

  • Species Rat; Mouse; Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • SMAD3 (M1-S425)
      Accession # Q8BUN5
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SMAD3; MAD, Mothers Against Decapentaplegic Homolog 3; Prev. MADH3; SMAD, Mothers Against DPP Homolog 3; JV15-2; SMA- And MAD-Related Protein 3; HsT17436; Mothers Against DPP Homolog; Mothers Against Decapentaplegic Homolog 3; Mad Protein Homolog; Mothers

  • AA Sequence

    MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

  • Molecular Weight

    Approximately 77 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00