SMAD3 Protein, Human/Mouse/Rat (GST)
The SMAD3 protein is an R-SMAD that acts as an intracellular signal transducer activated by TGF-β and activin type 1 receptor kinase.It binds TRE elements and regulates TGF-β target genes.SMAD3 Protein, Human/Mouse/Rat (GST) is the recombinant rat-derived SMAD3 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
- Species: Rat; Mouse; Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The SMAD3 protein is an R-SMAD that acts as an intracellular signal transducer activated by TGF-β and activin type 1 receptor kinase.It binds TRE elements and regulates TGF-β target genes.SMAD3 Protein, Human/Mouse/Rat (GST) is the recombinant rat-derived SMAD3 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
Background
The SMAD3 protein serves as a receptor-regulated SMAD (R-SMAD), functioning as an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. It binds the TRE element in the promoter region of genes regulated by TGF-beta, and upon forming the SMAD3/SMAD4 complex, activates transcription. Additionally, SMAD3 can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. This protein plays a role in wound healing, potentially modulating the growth and migration of primary keratinocytes and altering TGF-mediated chemotaxis of monocytes, with its impact on wound healing being hormone-sensitive. SMAD3 also acts as a regulator of chondrogenesis and osteogenesis and inhibits the early healing of bone fractures. Furthermore, it positively regulates PDPK1 kinase activity by stimulating its dissociation from the negative regulator 14-3-3 protein YWHAQ. The protein exists as a monomer in the absence of TGF-beta and forms a homooligomer in its presence, or a heterotrimer with C-terminally phosphorylated SMAD2 or SMAD3 and SMAD4 to form the transcriptionally active SMAD2/SMAD3-SMAD4 complex. SMAD3 interacts with various proteins involved in diverse cellular processes, including signal transduction, transcriptional regulation, ubiquitination, and protein-protein interactions.
Technical Parameters
-
Species Rat; Mouse; Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
P84022-1/Q8BUN5/P84025 (M1-S425)
-
Gene ID4088/17127/25631
-
Molecular Construction
-
N-term
-
GST
-
SMAD3 (M1-S425)
Accession # Q8BUN5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SMAD3; MAD, Mothers Against Decapentaplegic Homolog 3; Prev. MADH3; SMAD, Mothers Against DPP Homolog 3; JV15-2; SMA- And MAD-Related Protein 3; HsT17436; Mothers Against DPP Homolog; Mothers Against Decapentaplegic Homolog 3; Mad Protein Homolog; Mothers
-
AA Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
-
Molecular Weight
Approximately 77 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)